ORFeome > 1810034m08rik – XORFeome 2.0

1810034m08rik – XORFeome 2.0

General Information

Species: Xenopus tropicalis RIKEN cDNA 1810034M08 gene, mRNA (cDNA clone MGC:75657 IMAGE:5379754), complete cds
Gene Symbol: 1810034m08rik
Gene ID: 394950
ORF gb_acc: MG132855
ORF ID: 10209

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064176

Library Location

Plate ID: GDExt11003
Well Location: D02

EST Sequences

Clone: MGC:75657 IMAGE:5379754
Trimmed Sequence: ATGACTGAAACATATAAGTTGGAATTATTTCCTGACTGGAAGGCTACACTGTTATTGTTTAAAAATGTACAAAATTCAGCAGATTTAAGAAGAAAAGCAATTGATGGATCTATTGATGGTACTTTGCTAAATCCTGCAATGATTGTTGATCCATTTCAAATTCTTGTAGCAGTAAACAAAGCAATCCATCTACAGATGCTGGGGAAAATGAAAACAAGAACCCTTAATTCAGAGATTCTCTTCAACCTATCCCCTACAAACAATATTTCGGAAGCTTTTAAAAAATTTGGCTTGGCTGACAATGATTCTGGAGTTCTTATTGTTTTGACTGAAGATGGGACTAAAAAATCTCAAGAAATAATCTCTCAGATTGATGGCGAACAGGTTCCTATAACTGCACTGACGGAGTTCACAGACATTAAAAAAGTAAAAAAGATGTATAAACTAACTGCACAAGAAGAAAAAATTAGCACTGTCCTTGAGGCTGTACTCTGCAGAATGTCAGCTAAAGATGTTGTGTAA
Full Trace Sequence: gtaaatcttggaagcgtgatactgtggtatactagtgggcgactggtgctaacttaaacttcagataactaagggaaagacgtaacggaacaaatcattgtcattgcttgacaatgactgaaacatataagttggaattatttcctgactggaaggctacactgttattgtttaaaaatgtacaaaattcagcagatttaagaagaaaagcaattgatggatctattgatggtactttgctaaatcctgcaatgattgttgatccatttcaaattcttgtagcagtaaacaaagcaatccatctacagatgctggggaaaatgaaaacaagaacccttaattcagagattctcttcaacctatcccctacaaacaatatttcggaagcttttaaaaaatttggcttggctgacaatgattctggagttcttattgttttgactgaagatgggactaaaaaatctcaagaaataatctctcagattgatggcgaacaggttcctataactgcactgacggagttcacagacattaaaaaagtaaaaaagatgtataaactaactgcacaagaagaaaaaattagcactgtccttgaggctgtactctgcagaatgtcagctaaagatgttgtgtaaagaagatctgttccagataaatgaaaagcatagcataatatttgtttcttactagttgctcaattactcctttttagttaaaagagatggaaaggttcaaaaactggggggtgccaaatgttagacaccccccagtgattgtaagcatttacctgataccccgagccagtgcccctgttagcagaaaactgcaccagcccgtggtacttctgtgccagcgatcctctttctgcttcttgtggctttgcatgcacagtagggtgaaatccccagtgattgaacctttctttctcctttaactctattctgcatgagtactttgtgctgttttgcagcaatatttttggttttgtaaatcaagcagataccagaattggactttcattacaaatattaagggtatagctgtaatagcactacctaaacaaactgagtgccagagatgagcattctcatgagaatttggattcatttctatttatctagatgagcaaaatgttttaacttttgtatattactattagtaaaatatttttcagaagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTETYKLELFPDWKATLLLFKNVQNSADLRRKAIDGSIDGTLLNPAMIVDPFQILVAVNKAIHLQMLGKMKTRTLNSEILFNLSPTNNISEAFKKFGLADNDSGVLIVLTEDGTKKSQEIISQIDGEQVPITALTEFTDIKKVKKMYKLTAQEEKISTVLEAVLCRMSAKDVV
Donor tissue: tadpole