ORFeome > actr3 – XORFeome 2.0

actr3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ARP3 actin-related protein 3 homolog, mRNA (cDNA clone MGC:89264 IMAGE:6976699), complete cds
Gene Symbol: actr3
Gene ID: 394999
ORF gb_acc: MG133812
ORF ID: 11386

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075462

Library Location

Plate ID: GDExt11013
Well Location: F12

EST Sequences

Clone: MGC:89264 IMAGE:6976699
Trimmed Sequence: ATGGCGGCTCGGCTCCCGGCTTGTGTGGTGGATTGTGGCACCGGGTACACCAAGCTCGGCTACGCGGGGAATACAGAGCCGCAATTCATCATCCCATCATGTATCGCTATCAAGGAGTCGGCCAAGGTGGGGGACCAGGCCCAGCGGCGCCTAATGAAAGGGGTGGATGATCTGGATTTCCACATTGGGGATGAAGCCATAGACAAGCCGACATACGCAACTAAGTGGCCCATTCGCCATGGGATTGTGGAGGATTGGGACCTCATGGAGAGATTCATGGAACAAATCATCTTCAAATATCTCCGAGCAGAACCTGAAGATCATTACTTCCTCCTGACGGAACCCCCCCTGAATACCCCAGAGAACAGGGAATACACTGCTGAAATCATGTTTGAGTCTTTCAACGTCCCAGGGCTGTACATTGCTGTTCAGGCTGTTCTGGCCCTGGCTGCATCCTGGACCTCTCGGCAGGTTGGAGAGCGTACGCTCACTGGCACGGTGATAGACAGCGGCGATGGAGTCACACACGTCATTCCTGTGGCTGAAGGTTACGTCATTGGAAGCTGCATTAAACACATTCCTATTGCTGGTCGGGACATTACCTACTTCATACAGCAGTTACTCCGGGACAGGGAAGTGGGAATTCCACCGGAGCAATCGCTGGAAACTGCCAAGGCTGTAAAGGAGCGGTTCAGCTACGTGTGCCCGGATTTAGTTAAGGAATTTAGCAAATACGATACAGACGGTGCCAAATGGATCAAACAGTACACGGGGGTGAATGCCGTTTCTAAGAAGGAATTCAGCATTGACGTTGGTTACGAGCGCTTTCTGGGGCCCGAAATCTTCTTTCATCCAGAGTTTGCCAATCCAGATTTCACCCAGCCCATATCGGAAGTGGTGGATGAAGTGATACAGAACTGCCCTATTGACGTTCGGCGCCCCCTGTACAAGAATATCGTACTCTCTGGGGGCTCCACTATGTTCCGCGACTTTGGCCGGCGCTTACAGAGGGATGTAAAGAGAACGGTCGATGCCCGGCTGAAGCTGAGTGAGGAGCTGAGTGGGGGTCGCCTTAAGCCCAAGCCCATTGACGTTCAGGTGATCACCCACCACATGCAGAGGTACGCTGTTTGGTTCGGGGGATCCATGCTGGCTTCCACGCCGGAGTTTTACCAAGTGTGCCACACCAAGAAGGACTATGAAGAGATTGGGCCGAGCATATGTCGCCACAACCCCGTGTTCGGTGTCATGTCCTAA
Full Trace Sequence: gttcgtaactcggacatggcggctcggctcccggcttgtgtggtggattgtggcaccgggtacaccaagctcggctacgcggggaatacagagccgcaattcatcatcccatcatgtatcgctatcaaggagtcggccaaggtgggggaccaggcccagcggcgcctaatgaaaggggtggatgatctggatttccacattggggatgaagccatagacaagccgacatacgcaactaagtggcccattcgccatgggattgtggaggattgggacctcatggagagattcatggaacaaatcatcttcaaatatctccgagcagaacctgaagatcattacttcctcctgacggaaccccccctgaataccccagagaacagggaatacactgctgaaatcatgtttgagtctttcaacgtcccagggctgtacattgctgttcaggctgttctggccctggctgcatcctggacctctcggcaggttggagagcgtacgctcactggcacggtgatagacagcggcgatggagtcacacacgtcattcctgtggctgaaggttacgtcattggaagctgcattaaacacattcctattgctggtcgggacattacctacttcatacagcagttactccgggacagggaagtgggaattccaccggagcaatcgctggaaactgccaaggctgtaaaggagcggttcagctacgtgtgcccggatttagttaaggaatttagcaaatacgatacagacggtgccaaatggatcaaacagtacacgggggtgaatgccgtttctaagaaggaattcagcattgacgttggttacgagcgctttctggggcccgaaatcttctttcatccagagtttgccaatccagatttcacccagcccatatcggaagtggtggatgaagtgatacagaactgccctattgacgttcggcgccccctgtacaagaatatcgtactctctgggggctccactatgttccgcgactttggccggcgcttacagagggatgtaaagagaacggtcgatgcccggctgaagctgagtgaggagctgagtgggggtcgccttaagcccaagcccattgacgttcaggtgatcacccaccacatgcagaggtacgctgtttggttcgggggatccatgctggcttccacgccggagttttaccaagtgtgccacaccaagaaggactatgaagagattgggccgagcatatgtcgccacaaccccgtgttcggtgtcatgtcctaatcccgcgtgtgctgggaggggccggtgtgcgtgtcgggacgttggggcgcccaggcttggaggagccccccaatttctctttgcacgggtggaacccagacagattcctttccatgaaatattgttgaataaaagaagcgagtggcttttagttgtctgtgccctggggttctgtctgcttctggcagctcctacagttatgggttgcgctggttctgtagaactcgtgcggtacagacgaaccgggccccaaatgctggacattgggatcagcttatgtgctcagtgggcaatgtggcccctgagagccccgagctcctcccccgctttgcctttctgccctgtctggatactgagcgcttttccctatagttctgtctgtgtcggttccgctcgctcttccgcttctgggtttttgtttttgttttgaatctgaaaatccaataataaacgatatcatgatgtctcttcttacaaaaaaaaaaaaaaaa
Translation: MAARLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAIDKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Donor tissue: tailbud