ORFeome > akirin2 – XORFeome 2.0

akirin2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis akirin 2, mRNA (cDNA clone MGC:76154 IMAGE:5335312), complete cds
Gene Symbol: akirin2
Gene ID: 394510
ORF gb_acc: MG132723
ORF ID: 10019

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061612

Library Location

Plate ID: GDExt11001
Well Location: F10

EST Sequences

Clone: MGC:76154 IMAGE:5335312
Trimmed Sequence: ATGGCGTGCGGAGCCACACTTAAAAGGACTATCGAATTCGATCCTCTGTTGAGCCCAGCAGCATCCCCCAAGAGAAGAAGATGCGCCCCACTCTCTCCCCCGGGGCCCTCCCCACAGAAGTATCTTCGTATGGAGCCTTCACCCTTTGGGGAGGTGTCCCCGCGTCTTACCGCAGAGCAAATCCTTTATAACATAAAACAAGAGTATAAACGTATGCAAAAGCGAAGACATTTAGAAGCCAGCTTCCAGCCAACAGACCCCTGCTGCTCCAGTGAGGGACAGCCACAGACCTTTATCCCATCTGGGCCAACTTTACCAGGCACATCAGCTACATCTCCATTAAGAAAGGAGCAGCCATTGTTTTCATTAAGGCAAGTAGGAATGATATGTGAACGACTTCTTAAAGAACGTGAGGATAAAGTTCGTGAAGAATATGAAGAAATTTTGACCACAAAACTTGCAGAACAATATGATGCTTTTGTGAAATTCACGCATGATCAGATAATGCGACGATTTGGAGAACAGCCAGCTAGCTATGTTTCATGA
Full Trace Sequence: ttctggatagctgttgtgggtgtagatacggcgacaggatctctttccatcctagttcgtgaacgcttggaaggccccttcaactgcggaaaactgatccgggatcgctaacgagtagaactgtctggttctcgggtgtgaaggcgaccggcagtggtgcaaagagcgccctaagagaggcccctgggaaccttccctaatagtgtttgtacccgttgtggcaattgtgccgtgtgtttaggtgcctgtgccatggcgtgcggagccacacttaaaaggactatcgaattcgatcctctgttgagcccagcagcatcccccaagagaagaagatgcgccccactctctcccccggggccctccccacagaagtatcttcgtatggagccttcaccctttggggaggtgtccccgcgtcttaccgcagagcaaatcctttataacataaaacaagagtataaacgtatgcaaaagcgaagacatttagaagccagcttccagccaacagacccctgctgctccagtgagggacagccacagacctttatcccatctgggccaactttaccaggcacatcagctacatctccattaagaaaggagcagccattgttttcattaaggcaagtaggaatgatatgtgaacgacttcttaaagaacgtgaggataaagttcgtgaagaatatgaagaaattttgaccacaaaacttgcagaacaatatgatgcttttgtgaaattcacgcatgatcagataatgcgacgatttggagaacagccagctagctatgtttcatgagtcgttccttgcctttctcggctgccgttttcccttatttgctgcaagatgtcctagttaagaactgcagcaatgccatattccctttccctttgaacacaggttatttcaagcttttgtcagtggcaaccactcttacgcagcaactggttttggagtgctccctgatgtcagtgccactgggtgtggatctatgctacctgtattaaatataccaatggcctcatttgctgtatcatttaaaatttggcttcttttgttaatgttttaaaatggaaagcattaaagctggtgttaaagaatctgccctttgctaggtgtgtaaatagttcacgttagaacgccattttgtcgggttttaatgactgcactacaaacacaagcggcatccactaatacagatggaatcatttctgggacaattttaaagtgacatccagcagtttgactgtggggagcagaaaatgaaaaaaagggcatgcttgtattaaaggactctggggggtgggggcaaaggtaagaaaggatttgatttcttattttgtagtttatttattctatcagtctttaacaagtgtttaatgcaattttttccgtctatcattgtttaactgccttgtagtactggaatttagttggaataaaataaaaacacaaaaaaaaaaaaaaaaaa
Translation: MACGATLKRTIEFDPLLSPAASPKRRRCAPLSPPGPSPQKYLRMEPSPFGEVSPRLTAEQILYNIKQEYKRMQKRRHLEASFQPTDPCCSSEGQPQTFIPSGPTLPGTSATSPLRKEQPLFSLRQVGMICERLLKEREDKVREEYEEILTTKLAEQYDAFVKFTHDQIMRRFGEQPASYVS
Donor tissue: tailbud