ORFeome > ambp – XORFeome 2.0

ambp – XORFeome 2.0

General Information

Species: Xenopus tropicalis alpha 1 microglobulin/bikunin, mRNA (cDNA clone MGC:76314 IMAGE:5380002), complete cds
Gene Symbol: ambp
Gene ID: 394971
ORF gb_acc: MG132856
ORF ID: 10210

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064278

Library Location

Plate ID: GDExt11003
Well Location: C03

EST Sequences

Clone: MGC:76314 IMAGE:5380002
Trimmed Sequence: ATGACTGCCTGCTGGGCCCTAATACTGCTCTCTGGGCTCCTGGCGCTGGGAAGGTCCAGCCCGGTCCAAACACAAGAAGATATTCAGGTCCAGGAGAATTTTGATCTCCAAAAGATTTATGGGAAATGGTACGACGTCGCCATAGGCTCCACCTGCAAATGGCTGAAGCTCCACAAAGACAAGTTAAACATGGGGACACTGGAGCTTAGCGAGGGGGAGGCGGACGGGGAGGTCCGGATCGTGAACACAAGGATGAGGCACGGAACCTGCTCTCAGATTGTTGGAGCCTATCAGAAGACTGAGACCCCAGGGAAGTTCGACTACTTCAACCAACGGTGGGGAACCACAATCCAGAACTACATTGTCTTCACCAACTACAATGAGTACGCCATCATGCTGATGAGGAAGAAGAAGGGCACGGAGACCACCACGACTGTCAAGCTGTACGGGCGGAGCCCAGACCTGAGGCCGGTTCTCATCGATGAGTTCCAGCAGTTTGCCCTGGCTCAGGGCGTTCCGGAAGATTCCATCTTCACCCTAACAAACAGCGGTGAGTGCGCTCCGGGGGATATTGAAGTGAGACCCCGGAGAACTCAGAGGGCGGTCCTTCCCGAGGAAGAGGAGGGGTCTGGAATGGAGAACAACCCCCTATCCAGAAATAAGGGAGACTCCTGTAGGTTGGCCCCGGCCCCGGGCCCTTGCTTGGGCATGCACAGCCGCTACTTCTACAACTCTTCCACCATGGCCTGCGAGACCTTCAAATATGGCGGCTGCCTGGGGAACAACAACAACTTCCACTCCGAGAAAGAATGTCTGCAAACCTGCAGGACGGAAGCTGCCTGTCGGTTGCCCATTACCCCCGGCCCATGTAAAGCGGCCAAGACTCATTGGGCCTTTGATGCGGCACAAGGAAAGTGCGTGACATTCGCCTACGGCGGTTGCCAGGGTAACGGAAACCAGTTCTACACCGAGAAGGAGTGCAAGGAGTACTGCGGGGTAGTGAAGGATGTGAGTGACGAGTTACTGTAA
Full Trace Sequence: agcgcaaatacgggggagacatgactgcctgctgggccctaatactgctctctgggctcctggcgctgggaaggtccagcccggtccaaacacaagaagatattcaggtccaggagaattttgatctccaaaagatttatgggaaatggtacgacgtcgccataggctccacctgcaaatggctgaagctccacaaagacaagttaaacatggggacactggagcttagcgagggggaggcggacggggaggtccggatcgtgaacacaaggatgaggcacggaacctgctctcagattgttggagcctatcagaagactgagaccccagggaagttcgactacttcaaccaacggtggggaaccacaatccagaactacattgtcttcaccaactacaatgagtacgccatcatgctgatgaggaagaagaagggcacggagaccaccacgactgtcaagctgtacgggcggagcccagacctgaggccggttctcatcgatgagttccagcagtttgccctggctcagggcgttccggaagattccatcttcaccctaacaaacagcggtgagtgcgctccgggggatattgaagtgagaccccggagaactcagagggcggtccttcccgaggaagaggaggggtctggaatggagaacaaccccctatccagaaataagggagactcctgtaggttggccccggccccgggcccttgcttgggcatgcacagccgctacttctacaactcttccaccatggcctgcgagaccttcaaatatggcggctgcctggggaacaacaacaacttccactccgagaaagaatgtctgcaaacctgcaggacggaagctgcctgtcggttgcccattacccccggcccatgtaaagcggccaagactcattgggcctttgatgcggcacaaggaaagtgcgtgacattcgcctacggcggttgccagggtaacggaaaccagttctacaccgagaaggagtgcaaggagtactgcggggtagtgaaggatgtgagtgacgagttactgtaatttataaaccaatcagcaagccgtgaacccaccgggggggcgctatccccccattcgccagaggaacccgcaaaacagccaattggcagccgccccccccccccccctgtaaatctgatgggaggaaacaagatgatctttggccttgggggggtctgtgatgtttggggggggcagcttgaagccaaatacccttaataaactgttattccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTACWALILLSGLLALGRSSPVQTQEDIQVQENFDLQKIYGKWYDVAIGSTCKWLKLHKDKLNMGTLELSEGEADGEVRIVNTRMRHGTCSQIVGAYQKTETPGKFDYFNQRWGTTIQNYIVFTNYNEYAIMLMRKKKGTETTTTVKLYGRSPDLRPVLIDEFQQFALAQGVPEDSIFTLTNSGECAPGDIEVRPRRTQRAVLPEEEEGSGMENNPLSRNKGDSCRLAPAPGPCLGMHSRYFYNSSTMACETFKYGGCLGNNNNFHSEKECLQTCRTEAACRLPITPGPCKAAKTHWAFDAAQGKCVTFAYGGCQGNGNQFYTEKECKEYCGVVKDVSDELL
Donor tissue: tadpole