ORFeome > asb12 – XORFeome 2.0

asb12 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ankyrin repeat and SOCS box-containing 12, mRNA (cDNA clone MGC:75891 IMAGE:5383287), complete cds
Gene Symbol: asb12
Gene ID: 394543
ORF gb_acc: MG133016
ORF ID: 10404

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061350

Library Location

Plate ID: GDExt11005
Well Location: C02

EST Sequences

Clone: MGC:75891 IMAGE:5383287
Trimmed Sequence: ATGCTTCAGCTCAGAGGGCATGAATATGACCTTGCAGAAAGCCGTCGGCTACACCTTACAGTGGCAATGGATGACCCACAACAACTCAGTGAGCTGCTGTCTCAAACCAGATACAAGGAAGTTATAAACAGCCCTAGTGGCTGGGGTGTTCCAGAAACCCCTCTCCGTTGTGCTGCCTCTCAGGGCTTTTTAGACTGTCTTAAAATTCTGTTGGACAATGGAGCAGAGGTGGACAGTTTAGATGTGAAGGCCCAGACTCCACTTTTTACTGCTGTCAGTGCTGGCCATTTGGAATGTGTAAAAGAATTACTGCAAGCTGGAGCAGATCCTTGCGGCAGTGCCTACAATAACTGTTCCCCTTTACTCATTGCAGCACATAATAGGAATGACAAGATATTAGTGGAACTCTTTAAATATGGAGCAGAAGCCAATGTCAAGTCAAAACGTTCTGACTGTGCTTTAAGTATTAAGACCTCTACTGGACCCTTATATATTTCAGCTATATATGACCGCTTACATTGTTTCAAGACTTTGCTTCTTTATGGCGCTGACCCAGATTACAACTGCACAGATCCGAAACTTTTACAGAGGATCAAGCACCCCAGGCCAGTGCTGGAGATATGCCTGAAACACAGAGTGAGGGTAGACTATGTGAAATTGCTTATTGATTTTGGGGCCAATATTCACTTGGTTGATGAAGATGTTATTAAACTATTCGTAAATGGCGAAGCAGCGGACCTATTGATGCAAGAAAGGGGTCATCCAAGGACATTAATGTCTCAGTGTCGCTTGACCATAAGAAGCCTACTAGTACGACTAAGAAAGATTCATCTCATTGACAAGCTGCAGATCCCCCAAGCACTGATCAACTATTTACAGTATGAACCCTAA
Full Trace Sequence: gatgagctgcaaagcgattcagccagagaaagtgatccccgaaagaagaaacatataagattcttctagaaagatctggttatcgcgtataccaataggggcattatgcttcagctcagagggcatgaatatgaccttgcagaaagccgtcggctacaccttacagtggcaatggatgacccacaacaactcagtgagctgctgtctcaaaccagatacaaggaagttataaacagccctagtggctggggtgttccagaaacccctctccgttgtgctgcctctcagggctttttagactgtcttaaaattctgttggacaatggagcagaggtggacagtttagatgtgaaggcccagactccactttttactgctgtcagtgctggccatttggaatgtgtaaaagaattactgcaagctggagcagatccttgcggcagtgcctacaataactgttcccctttactcattgcagcacataataggaatgacaagatattagtggaactctttaaatatggagcagaagccaatgtcaagtcaaaacgttctgactgtgctttaagtattaagacctctactggacccttatatatttcagctatatatgaccgcttacattgtttcaagactttgcttctttatggcgctgacccagattacaactgcacagatccgaaacttttacagaggatcaagcaccccaggccagtgctggagatatgcctgaaacacagagtgagggtagactatgtgaaattgcttattgattttggggccaatattcacttggttgatgaagatgttattaaactattcgtaaatggcgaagcagcggacctattgatgcaagaaaggggtcatccaaggacattaatgtctcagtgtcgcttgaccataagaagcctactagtacgactaagaaagattcatctcattgacaagctgcagatcccccaagcactgatcaactatttacagtatgaaccctaaggcagatgattctctagagcagtgaatatgctgctgaactacaactcctggaaatggatgctgcagtttagcaactggactggttcaaattgaattttctaggatgcaaaactcccattattgaaatcagaaatttaaaaagacaacctgcacctctagttgctgttgaactacaagtaccagactttaagccattgtgagatgctgggaattaaaggcacaactagagggcaataattggcgtagccttgtttggtcagtatactaatcatattgtaaataaagttcacactaactaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLQLRGHEYDLAESRRLHLTVAMDDPQQLSELLSQTRYKEVINSPSGWGVPETPLRCAASQGFLDCLKILLDNGAEVDSLDVKAQTPLFTAVSAGHLECVKELLQAGADPCGSAYNNCSPLLIAAHNRNDKILVELFKYGAEANVKSKRSDCALSIKTSTGPLYISAIYDRLHCFKTLLLYGADPDYNCTDPKLLQRIKHPRPVLEICLKHRVRVDYVKLLIDFGANIHLVDEDVIKLFVNGEAADLLMQERGHPRTLMSQCRLTIRSLLVRLRKIHLIDKLQIPQALINYLQYEP
Donor tissue: neurula