ORFeome > asb9 – XORFeome 2.0

asb9 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ankyrin repeat and SOCS box-containing protein 9, mRNA (cDNA clone MGC:89290 IMAGE:6981223), complete cds
Gene Symbol: asb9
Gene ID: 448606
ORF gb_acc: MG133833
ORF ID: 11410

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076943

Library Location

Plate ID: GDExt11014
Well Location: B01

EST Sequences

Clone: MGC:89290 IMAGE:6981223
Trimmed Sequence: ATGGGGCAGCCCCCAGAAATGTGCACTTCAAACCCATACATGAGCGACTTTGTTTCTGACTGGTCTCCAATACACGATGCATCTCTACACGGGCGCCTGTTGGCACTAAACAAACTCATCAACCAGGGCTACAGTGTAAACCAAATGACTGCAGATCGCATGTCCCCCCTTCATGAAGCTTGCCTAGGGGGCCACCCTGCCTGTGTCAGTCTCTTATTGAAACATGGAGCTCAGGTTAATACATTGGATATTGATTGGAAAACCCCAATATTTAATGCATGTATCAGTGGCAACGTGGACTGTGTAAATTTACTGCTGCAAAATGGTGCCAGCCCCCATCCAGCATGCGAGGTGGCGTCTCCAATCCATGAAGCATGTAAACGAGGACATACAGCATGTGTGGAGACTCTCTCATCGGCTGGAGTGAGTGTACAGCAATATATCAAACATCTGGGCTCTCCTCTTTACGTTGCCTGTGAGAACCAAAGGGTTGACACTGCCAAAAAGCTACTTGAATTTGGGGCAAATGCAAATGTTGGGAAAGATCTGGAGTCGCCTTTACATGCCGCTGCAAGAACCGGGAATAGTGACTTGGTGAAGTTGCTTATTGACTATGACGGGAGTGCGCAGTGCAGGAACGCTGAAGGGAAACGCCCGACGGATTTGGTCCCACCACACTGTGATTTAAAACAAGTTTTTCTGAAGCAAGAAGGCCCCGTGAGTTTGATGCAGACATGTCGCCTCTGCATTAGGAATTGCTTTGAGGAAAAACAACACTACAAAATATGCCATCTCCAGCTTCCAGATACCCTGAAACATTTCTTATTATACAGATAA
Full Trace Sequence: gtagattccagctttccatttctctcttatatctgtgtgcaaataacaacttttggaattaaaaggacatagaggtatttaatatcagagcggactggatagggagcgtctgatcggtaatagcggcctggcttcctggttgcagagtttgtgagagaataaaagagagggagatgttgttatttgtgctgaatgggaatgctcgggttacacaggtactcccctgcactaaccttgtctgacaggacaggcatctttcccacaggataccagcacttcccacccgccttaatatgttatccatgtaaccaagcactctcattctcttgggaatttggactttataacatcaggcctccaaagaaaatatataaactcagtgtgcagaatggatgcctcggaagggagcggagtcatggggcagcccccagaaatgtgcacttcaaacccatacatgagcgactttgtttctgactggtctccaatacacgatgcatctctacacgggcgcctgttggcactaaacaaactcatcaaccagggctacagtgtaaaccaaatgactgcagatcgcatgtccccccttcatgaagcttgcctagggggccaccctgcctgtgtcagtctcttattgaaacatggagctcaggttaatacattggatattgattggaaaaccccaatatttaatgcatgtatcagtggcaacgtggactgtgtaaatttactgctgcaaaatggtgccagcccccatccagcatgcgaggtggcgtctccaatccatgaagcatgtaaacgaggacatacagcatgtgtggagactctctcatcggctggagtgagtgtacagcaatatatcaaacatctgggctctcctctttacgttgcctgtgagaaccaaagggttgacactgccaaaaagctacttgaatttggggcaaatgcaaatgttgggaaagatctggagtcgcctttacatgccgctgcaagaaccgggaatagtgacttggtgaagttgcttattgactatgacgggagtgcgcagtgcaggaacgctgaagggaaacgcccgacggatttggtcccaccacactgtgatttaaaacaagtttttctgaagcaagaaggccccgtgagtttgatgcagacatgtcgcctctgcattaggaattgctttgaggaaaaacaacactacaaaatatgccatctccagcttccagataccctgaaacatttcttattatacagataatatagacctatttatttgattgtatagctaataaaatgttatctttttttatttaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGQPPEMCTSNPYMSDFVSDWSPIHDASLHGRLLALNKLINQGYSVNQMTADRMSPLHEACLGGHPACVSLLLKHGAQVNTLDIDWKTPIFNACISGNVDCVNLLLQNGASPHPACEVASPIHEACKRGHTACVETLSSAGVSVQQYIKHLGSPLYVACENQRVDTAKKLLEFGANANVGKDLESPLHAAARTGNSDLVKLLIDYDGSAQCRNAEGKRPTDLVPPHCDLKQVFLKQEGPVSLMQTCRLCIRNCFEEKQHYKICHLQLPDTLKHFLLYR
Donor tissue: gastrula