ORFeome > atf4 – XORFeome 2.0

atf4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis activating transcription factor 4 (tax-responsive enhancer element B67), mRNA (cDNA clone MGC:69565 IMAGE:5379059), complete cds
Gene Symbol: atf4
Gene ID: 448005
ORF gb_acc: MG133423
ORF ID: 10934

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074520

Library Location

Plate ID: GDExt11009
Well Location: E05

EST Sequences

Clone: MGC:69565 IMAGE:5379059
Trimmed Sequence: ATGCTGTTGGGGGACCTTCTGTCCCCCTTCAACCAGTCGTTTTTGGCGGCTGAAAAGAGTTTGGGTCTCTTGGAGGATGAATTTGAGGTGCCCGGGTACCTCCTATCGCAAGGGTTCTCCAGCGACAAGGCTAAGGATGGCGTCTCTGACCTGCTGCCTTATGTTGAATCTTTAGGCAGTTTTCATGGGGACGCCTTCTCCGGCATGGATTGGATGGTGGAAAAGATGGATCTGAAGGAATTTGATTTAGACTCCCTGTTTGGGTTGGAAGATCTGGAATCCACTATCTCACCAGATGAGCTAACATCCACGTTGGAAGACTCATGTGATTTCCTAGAGGACCCACCTCATGCAGCAGTGATTGGCCACTTTGTGCCATCACCTGAACCTGTCTCCCTTCCAGAGTCCCCACTGGATGCTGACCAGGTTGCCCCATTTAGCCCAGATTTGACAGCCTCTCTCTCCTCTAGCCCAGACCATTCCTTCATCTTGGATGTAGGTAGTGAGGTAGATGTTGCAGAGGATGAGAAAAAGTCCTCTGCAACATATACTCTAGAGATACTTAAATGTGAGAAGGAAGATTCCTCTGATAATGATAGTGGAATCAGCATGAGCCCCTCCTACTTGGAATCCCCTCAGCAGAGTCCATCAACTGTAGAATGCTATAGTAGTCCTCAGTCCTCCCTAGAGTCCCCAGTCTCTGAGAGACCCAAACCTTATGATCTTCCCTGTAAGGATAGAGATGTGATGGCGAAGGTGAAAGTAGCTGGAGGGCAGCCCAGAGTAGACAAGAAGAAAAAGAAAATGGAGCAGAACAAAACAGCAGCCACTCGCTACAGACAGAAGAAAAGAGCAGAGCAAGAGTTAATATCTGGAGAGTGCAGAGAACTAGAGGGAAAAAATGATACCCTTAGAGAAAAAGTAGATTCGTTAACAAAAGAGATCCAGTATTTGAAAGATCTGATAGCTGAAGTCCGACAGGCCAAAAGCAAACGAGCAAAAAGTTCTTGA
Full Trace Sequence: cttggaatgaaagagggaacgtagtttgctgtcgctgggtcttttttgttaactaaatactaaggtttgaggacgcgacgcttctgctgtagcaggttccaacagtgatttcttcagtccggcgccgcaataaccagcggacaaccatggcgctatagcggcagcacaggcctgcggctcccctctcccccggccatagcgaggcagcagctcccagcggcgcccgcagcaccaggcaacggcacagccatggcgcttctccaggcatcccacagcagcattgctgtatacgaggaagaaagctcaaaattgtcatcaccagtcgaattcgtgatcctacagaaagatgagtttgttaagcgacgagatgctgttgggggaccttctgtcccccttcaaccagtcgtttttggcggctgaaaagagtttgggtctcttggaggatgaatttgaggtgcccgggtacctcctatcgcaagggttctccagcgacaaggctaaggatggcgtctctgacctgctgccttatgttgaatctttaggcagttttcatggggacgccttctccggcatggattggatggtggaaaagatggatctgaaggaatttgatttagactccctgtttgggttggaagatctggaatccactatctcaccagatgagctaacatccacgttggaagactcatgtgatttcctagaggacccacctcatgcagcagtgattggccactttgtgccatcacctgaacctgtctcccttccagagtccccactggatgctgaccaggttgccccatttagcccagatttgacagcctctctctcctctagcccagaccattccttcatcttggatgtaggtagtgaggtagatgttgcagaggatgagaaaaagtcctctgcaacatatactctagagatacttaaatgtgagaaggaagattcctctgataatgatagtggaatcagcatgagcccctcctacttggaatcccctcagcagagtccatcaactgtagaatgctatagtagtcctcagtcctccctagagtccccagtctctgagagacccaaaccttatgatcttccctgtaaggatagagatgtgatggcgaaggtgaaagtagctggagggcagcccagagtagacaagaagaaaaagaaaatggagcagaacaaaacagcagccactcgctacagacagaagaaaagagcagagcaagagttaatatctggagagtgcagagaactagagggaaaaaatgatacccttagagaaaaagtagattcgttaacaaaagagatccagtatttgaaagatctgatagctgaagtccgacaggccaaaagcaaacgagcaaaaagttcttgaatagggaacaaagctggagcgtgtgtatgttgtatataggtcacttaagaatgttgtggaatgtctacttaataaattattttgtagttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLLGDLLSPFNQSFLAAEKSLGLLEDEFEVPGYLLSQGFSSDKAKDGVSDLLPYVESLGSFHGDAFSGMDWMVEKMDLKEFDLDSLFGLEDLESTISPDELTSTLEDSCDFLEDPPHAAVIGHFVPSPEPVSLPESPLDADQVAPFSPDLTASLSSSPDHSFILDVGSEVDVAEDEKKSSATYTLEILKCEKEDSSDNDSGISMSPSYLESPQQSPSTVECYSSPQSSLESPVSERPKPYDLPCKDRDVMAKVKVAGGQPRVDKKKKKMEQNKTAATRYRQKKRAEQELISGECRELEGKNDTLREKVDSLTKEIQYLKDLIAEVRQAKSKRAKSS
Donor tissue: tailbud