ORFeome > atp6v0c – XORFeome 2.0

atp6v0c – XORFeome 2.0

General Information

Species: Xenopus tropicalis ATPase, H+ transporting, V0 subunit C, mRNA (cDNA clone MGC:75730 IMAGE:5381080), complete cds
Gene Symbol: atp6v0c
Gene ID: 394488
ORF gb_acc: MG132929
ORF ID: 10296

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059745

Library Location

Plate ID: GDExt11004
Well Location: F04

EST Sequences

Clone: MGC:75730 IMAGE:5381080
Trimmed Sequence: ATGTCTACCGACACCGCAAGCGCGCCCGAGTACTCCGCCTTCTTCGCTGTCATGGGGGCTTCGTCTGCCATGGTTTTTAGCGCCTTAGGGGCGGCCTATGGCACGGCAAAAAGTGGTACAGGTATTGCCGCAATGTCTGTCATGCGGCCTGAGTTGATCATGAAGTCCATTATTCCCGTGGTCATGGCTGGTATCATTGCTATCTATGGTCTTGTAGTAGCAGTCCTTATTGCAAACTCTTTGACGTCTTCTATCACACTATACAAGAGCTTCCTTCAGTTGGGTGCTGGCCTCAGTGTAGGCCTGAGTGGTCTAGCTGCTGGCTTCGCCATTGGTATCGTGGGAGATGCCGGAGTGCGGGGTACAGCACAGCAGCCTCGACTATTCGTAGGGATGATCCTGATCCTCATTTTTGCTGAAGTCTTGGGTCTGTACGGCCTTATCGTGGCGCTTATCCTGTCTACAAAATGA
Full Trace Sequence: tggttggagtgtcctgtcattcccgcttcccctcctccttcccgtagcgtcgtgtgcactatctctctttccctcccctgagcccggcgcatttcttttatttctaccggagagtttacggacaactcgtcatccagcaccatgtctaccgacaccgcaagcgcgcccgagtactccgccttcttcgctgtcatgggggcttcgtctgccatggtttttagcgccttaggggcggcctatggcacggcaaaaagtggtacaggtattgccgcaatgtctgtcatgcggcctgagttgatcatgaagtccattattcccgtggtcatggctggtatcattgctatctatggtcttgtagtagcagtccttattgcaaactctttgacgtcttctatcacactatacaagagcttccttcagttgggtgctggcctcagtgtaggcctgagtggtctagctgctggcttcgccattggtatcgtgggagatgccggagtgcggggtacagcacagcagcctcgactattcgtagggatgatcctgatcctcatttttgctgaagtcttgggtctgtacggccttatcgtggcgcttatcctgtctacaaaatgaaaaattcgacctctttccagttcatctgttatccaaaagtcaacacttgcaaataatggttttatctcatgtgtacagtcatcctacacctgccccaaactcaatattttctcccccccacgatacctgcgcagttgtaagttagtgactgttgtgtgtaatcctttagctatcttcatcagttggacttcagggcattaccagtcctgacaagcaggcttgtgggtgggaagcaggcatcacttcctctaccctcacctgactccttcctctgcgtgcagtgtgtttctcccattccatctgattgtttcctaacaagttccatgtataaatatgatcctagaactgtaatttcccctttacacttaatgttttatttatataaaaattcttgttcatacttcaaaaacagagccagctttttcctcccttctgtaacctatcctggtctctttgctgcgtatatatttaatctttagctgtatctgtgtgggatttccttgtaagtgctgagaattccctggatgtaataatttggattacgattgctgtattgttctgatattggagtgaggtctctatatatagttatatatttttgttttttttgttttaatacaaaaaattaaattccagcctgtgttcaactggtgaccagaacaaaattttaaaagcaaaacctggacatgtatggtaaagttacgcctgctgctggggttcagttacacatttccgaataaaacatctccaatccattaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSTDTASAPEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Donor tissue: tadpole