ORFeome > atp6v1c1 – XORFeome 2.0

atp6v1c1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ATPase, H+ transporting, lysosomal V1 subunit C1, mRNA (cDNA clone MGC:75601 IMAGE:5379234), complete cds
Gene Symbol: atp6v1c1
Gene ID: 394779
ORF gb_acc: MG132780
ORF ID: 10098

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063194

Library Location

Plate ID: GDExt11002
Well Location: A03

EST Sequences

Clone: MGC:75601 IMAGE:5379234
Trimmed Sequence: ATGACTGAGTTCTGGTTAATCTCTGCTCCTGGAGAGAAAACATGCCAACAGACCTGGGAAAAGCTGATGGCTGCCACCACCAAGAATAACAATCTGTCTACAAATGCCAAGTTTAACATACCAGACCTGAAGGTGGGCACTCTGGATGTGCTGGTCGGACTCTCTGACGAACTGGCTAAACTGGACGCGTTTGTTGAAGGAACAGTGAAGAAGGTAGCACAGTATATGGCTGATGTTTTGGAGGACAGCCGAGATAAAGTTCAAGAAAACCTTTTGGCCAATGGAGTGGATTTGGTGACATACATAACCAGGTTCCAATGGGATATGGCAAAGTACCCGATTAAACAGTCGCTAAAGAATATTTCGGAAATAATCGCAAAAGGTGTAACACAGATCGACAATGATCTCAAAGCAAGAGCTTCTGCATACAATAACCTGAAAGGAAATCTACAGAATCTGGAGAGAAAAAATGCAGGAAGTTTAATTACAAGAAGTCTGGCTGAAATTGTGAAGAAAGACGACTTTGTGCTGGATTCAGAATATCTGATTACACTTTTGGTAGTAGTTCCAAAAAATAACTATAACGACTGGGTCAAGCAATATGAAACCCTCGCTGAGATGGTTGTTCCTCGATCCAGCAATGTTCTTTCAGAAGACCAGGACAGTTACCTCTGTAATGTCACTCTGTTCAGGAAAGCTGTGGATGACTTCAGGCACAAAGCAAGAGAAAATAAGTTTGTTGTCCGTGACTTCCAGTACAACGAAGAGGAAATGAAAGCGGATAAGGAAGAAATGAACAGACTTTCCACAGATAAGAAGAAACAGTTTGGACCTCTGGTACGATGGCTTAAAGTCAATTTCAGTGAAGCTTTTATTGCCTGGATTCATGTGAAAGCCTTGAGAGTCTTCGTTGAGTCTGTGTTACGGTATGGCTTGCCAGTTAACTTCCAAGCCATGCTGCTTCAGCCCAACAAGAAGACCATGAAGAAACTAAGGGAAGTTCTGTATGATTTGTACAAACATCTGGACAGCAGTGCTGCCTCCATAATAGATGCTCCTATGGATATCCCTGGACTAAACCTCAGCCAGCAAGAATACTACCCCTATGTGTACTACAAGATTGACTGCAACTTGTTGGAATTTAAGTAA
Full Trace Sequence: gtctgcgtgatagaggatggcggaggtctgctgagcccactggatacggaacaccgagccattcatcgttaccgagcgggggaacgggaagggaggtacaagcctgtcactgtgacttctcctattcatcttcctgtctgctgcttaaaccactaccactgctaggttcttcttttgtaaagagcactgaagatctgcagccatgactgagttctggttaatctctgctcctggagagaaaacatgccaacagacctgggaaaagctgatggctgccaccaccaagaataacaatctgtctacaaatgccaagtttaacataccagacctgaaggtgggcactctggatgtgctggtcggactctctgacgaactggctaaactggacgcgtttgttgaaggaacagtgaagaaggtagcacagtatatggctgatgttttggaggacagccgagataaagttcaagaaaaccttttggccaatggagtggatttggtgacatacataaccaggttccaatgggatatggcaaagtacccgattaaacagtcgctaaagaatatttcggaaataatcgcaaaaggtgtaacacagatcgacaatgatctcaaagcaagagcttctgcatacaataacctgaaaggaaatctacagaatctggagagaaaaaatgcaggaagtttaattacaagaagtctggctgaaattgtgaagaaagacgactttgtgctggattcagaatatctgattacacttttggtagtagttccaaaaaataactataacgactgggtcaagcaatatgaaaccctcgctgagatggttgttcctcgatccagcaatgttctttcagaagaccaggacagttacctctgtaatgtcactctgttcaggaaagctgtggatgacttcaggcacaaagcaagagaaaataagtttgttgtccgtgacttccagtacaacgaagaggaaatgaaagcggataaggaagaaatgaacagactttccacagataagaagaaacagtttggacctctggtacgatggcttaaagtcaatttcagtgaagcttttattgcctggattcatgtgaaagccttgagagtcttcgttgagtctgtgttacggtatggcttgccagttaacttccaagccatgctgcttcagcccaacaagaagaccatgaagaaactaagggaagttctgtatgatttgtacaaacatctggacagcagtgctgcctccataatagatgctcctatggatatccctggactaaacctcagccagcaagaatactacccctatgtgtactacaagattgactgcaacttgttggaatttaagtaaaaacaaacctgttatcctgttgtcagagctgaaatgagtttaaagtacagagagagacagtttaccagctaaccctgtgcttgcttctcattcctcttagcccggtgttatccgcatagttcctgtcattcaccccaaaactttttcttttaaagaatgttctatagatattgttgcttttaatcaatgaggtatttaaatgtccactgaacaaataagagtctatttataaagagatttatttaactcctgcagtgcgagagcagtcagtgtggcatgtcggaaactccctaacccaaaggttctccctcctcccattcctcattcgtatggtgttaaatattcattttgtaatgtcgctgcccatatagatcttgtttacaaggggccatggtgtaattgttttataccattccattcactgtatttagtccataaagctgttcagatgtggcgttgtgatgtcaagtgcaatgtaattctatttaatatatacgtgctttctgaatgtttgatgaagatctgggagcactgtctgtactcacaggaggaataaaacatacctgtgcaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTEFWLISAPGEKTCQQTWEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVKKDDFVLDSEYLITLLVVVPKNNYNDWVKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFVVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSSAASIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Donor tissue: tailbud