ORFeome > bat1 – XORFeome 2.0

bat1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis HLA-B associated transcript 1, mRNA (cDNA clone MGC:75726 IMAGE:5381000), complete cds
Gene Symbol: bat1
Gene ID: 394669
ORF gb_acc: MG132958
ORF ID: 10334

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061280

Library Location

Plate ID: GDExt11003
Well Location: E07

EST Sequences

Clone: MGC:75726 IMAGE:5381000
Trimmed Sequence: ATGGCAGAGACAGATGTAGATAATGAACTACTGGACTATGAAGACGATGAGGTGGACAACCAGGCTGGAGTGGATGCTCCTGACATAACTGTCAAAAAGGAAATGAAGGGATCATATGTATCCATTCATAGCTCTGGTTTTAGAGACTTTTTGCTCAAGCCTGAGCTGCTTCGTGCCATTGTAGATTGTGGCTTTGAACATCCATCAGAAGTACAACATGAATGCATACCCCAAGCAATTCTTGGTATGGATATTTTATGTCAAGCAAAGTCTGGCATGGGAAAAACAGCAGTTTTTGTGTTAGCCACATTGCAACAGCTGGAACCTGTTACTGGGCAGGTCTCTGTATTAGTCATGTGTCACACAAGAGAGTTGGCTTTTCAAATCAGTAAGGAGTATGAGAGATTCTCCAAATATATGCCTTCTGTTAAGGTGGCAGTATTTTTTGGGGGGCTTGCTATTAAGAAAGATGAGGAGGTTCTGAAAAAGAGCTGTCCCCACATTGTGGTGGGAACACCAGGGCGAATGCTGGCGCTTGCAAGAAACAAGACTCTGAATCTGAAACACATCAAACATTTCATCCTTGATGAGTGTGACAAGATGTTAGAACAGCTAGACATGCGCAGAGATGTACAGGAAATTTTCCGCATGACACCACATGAGAAGCAGGTTATGATGTTCAGTGCCACACTGAGCAAGGAGATTCGCCCGGTTTGCCGCAAATTTATGCAAGATCCAATGGAAATCTTCGTGGATGATGAAACAAAGTTGACACTTCATGGACTGCAGCAGTATTACGTCAAACTGAAGGACAACGAGAAAAATCGTAAGCTGTTCGACCTTTTGGATCTCTTGGAGTTCAACCAGGTGGTGATCTTTGTGAAATCAGTCCAGCGCTGCATCGCACTTGCTCAGCTACTAGTGGAACAGAACTTCCCAGCCATAGCAATTCACCGTGGCATGTCACAAGAGGAAAGGCTCTCACGCTATCAACAATTTAAGGATTTCCAGAGGCGAATTTTAGTTGCTACAAACCTGTTTGGCCGTGGAATGGACATTGAGAGGGTTAACATTGCTTTCAACTATGATATGCCAGAGGACTCTGATACGTACCTGCACAGGGTGGCTCGAGCTGGCAGATTTGGTACAAAAGGTTTGGCTATTACATTTGTCTCTGATGAGGGGGATGCTAAAATTCTAAATGAAGTTCAAGATCGTTTTGAAGTTAACATCAGTGAGCTGCCTGATGAAATTGATATCTCCTCGTACATTGAACAGACACGGTGA
Full Trace Sequence: gccttctggaaccgaggaattggacgtcagaacggcgttgtgaatcctttaaagagattattatcaacacttaattaagagatatcacttctactcgctaaaaatggcagagacagatgtagataatgaactactggactatgaagacgatgaggtggacaaccaggctggagtggatgctcctgacataactgtcaaaaaggaaatgaagggatcatatgtatccattcatagctctggttttagagactttttgctcaagcctgagctgcttcgtgccattgtagattgtggctttgaacatccatcagaagtacaacatgaatgcataccccaagcaattcttggtatggatattttatgtcaagcaaagtctggcatgggaaaaacagcagtttttgtgttagccacattgcaacagctggaacctgttactgggcaggtctctgtattagtcatgtgtcacacaagagagttggcttttcaaatcagtaaggagtatgagagattctccaaatatatgccttctgttaaggtggcagtattttttggggggcttgctattaagaaagatgaggaggttctgaaaaagagctgtccccacattgtggtgggaacaccagggcgaatgctggcgcttgcaagaaacaagactctgaatctgaaacacatcaaacatttcatccttgatgagtgtgacaagatgttagaacagctagacatgcgcagagatgtacaggaaattttccgcatgacaccacatgagaagcaggttatgatgttcagtgccacactgagcaaggagattcgcccggtttgccgcaaatttatgcaagatccaatggaaatcttcgtggatgatgaaacaaagttgacacttcatggactgcagcagtattacgtcaaactgaaggacaacgagaaaaatcgtaagctgttcgaccttttggatctcttggagttcaaccaggtggtgatctttgtgaaatcagtccagcgctgcatcgcacttgctcagctactagtggaacagaacttcccagccatagcaattcaccgtggcatgtcacaagaggaaaggctctcacgctatcaacaatttaaggatttccagaggcgaattttagttgctacaaacctgtttggccgtggaatggacattgagagggttaacattgctttcaactatgatatgccagaggactctgatacgtacctgcacagggtggctcgagctggcagatttggtacaaaaggtttggctattacatttgtctctgatgagggggatgctaaaattctaaatgaagttcaagatcgttttgaagttaacatcagtgagctgcctgatgaaattgatatctcctcgtacattgaacagacacggtgaacctgaatctattctgcttcctgcgtgctgcttccctctgcattggttttcttctaagcgtgggaaaaggaactcaccagccaaaatgtcaccgaaagagcctggaagactatcttcatccagcccacatctgtgtattgtacattgaacacagcagcacacgtctttaaattccctttaagggtcctgcagactactgcaacagtggttaaaataacatagtagaaacttccagaacccatataatctagttccatttctgttggtattaataaaggagcagtgctctgtgggtttctggtatagtgttgtatttgattagttttataccgtatccagtgaggatcaacttttgtttagtaacactgctgtgaccggtgctgtcactgacttgtattttgtgaatttatgacaagaacatgtcacaaaaaaataaaagttactacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAETDVDNELLDYEDDEVDNQAGVDAPDITVKKEMKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVAVFFGGLAIKKDEEVLKKSCPHIVVGTPGRMLALARNKTLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDLLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMSQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDEGDAKILNEVQDRFEVNISELPDEIDISSYIEQTR
Donor tissue: tadpole