ORFeome > bcap31 – XORFeome 2.0

bcap31 – XORFeome 2.0

General Information

Species: Xenopus tropicalis B-cell receptor-associated protein 31, mRNA (cDNA clone MGC:75863 IMAGE:5382885), complete cds
Gene Symbol: bcap31
Gene ID: 394579
ORF gb_acc: MG133047
ORF ID: 10448

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061339

Library Location

Plate ID: GDExt11004
Well Location: D11

EST Sequences

Clone: MGC:75863 IMAGE:5382885
Trimmed Sequence: ATGAGTCTGCAGTGGACAGCCGTGGCAACCTTTCTGTATGTGGAAGTCTTTCTGGTGTTGCTGTTGTGCATTCCTTTCATTTCCCCCACAAGATGGCAGAAAATCTTTAAGTCCCGCCTGGTCCAGTTATTAGTGACGTATGGGAACACATTCTTCCTTGTCCTGATAGCGATTCTGGTGCTGTTATTACTAGATGCCTTCCGGGAAATTCAGAAATATGGAGTCGGGGAGCAGGTGGATCTTAAGAATAACCCGGTGGCCGTAGAGCACATCCACATGAAACTCTTCAGAGCTCAGCGCAATCTGTATATCGCTGGCTTCTCCCTGCTCCTGTCCTTCCTTCTGAGGCGGCTGGTCATGCTGATCTCCAAACAGGCTACTCTCTTGGCATCTAATGAGGCCTTCAGGAAGCAGGCAGAAAGCGCCAGTGATGCAGCCAAGAAGTACATGGAGGAAAATGACAAGTTAAAGAAGGAACTGAAGTCTTTAGGCGTGGAGGTGAGCGACCTGCCCGATAACAATGCTGAGGAGGATAACAAGAAGCTTAAAGAAGAAGTGCGCAAACTTAAGGAGGAGCTGGGGTCAGCAAGGAAAACCCTGCACAAGTCCGAGAGTGAGGTTGTGGCAATCAAGAAGCAGTGCGAAGGCCTAACCAAGGAGTATGACCGGCTGCTGGAAGAGCATTCTAGACTGCAGGCACAGTCAGATGGACCAAAGGACAAGAAAGACGACTGA
Full Trace Sequence: cggaaagcggaagggaagggggagtgaatgcgtgtggaagtcttacaagtggcaagaggaacagaaggcagtgtgaggttctgccagctgatacatcatgagtctgcagtggacagccgtggcaacctttctgtatgtggaagtctttctggtgttgctgttgtgcattcctttcatttcccccacaagatggcagaaaatctttaagtcccgcctggtccagttattagtgacgtatgggaacacattcttccttgtcctgatagcgattctggtgctgttattactagatgccttccgggaaattcagaaatatggagtcggggagcaggtggatcttaagaataacccggtggccgtagagcacatccacatgaaactcttcagagctcagcgcaatctgtatatcgctggcttctccctgctcctgtccttccttctgaggcggctggtcatgctgatctccaaacaggctactctcttggcatctaatgaggccttcaggaagcaggcagaaagcgccagtgatgcagccaagaagtacatggaggaaaatgacaagttaaagaaggaactgaagtctttaggcgtggaggtgagcgacctgcccgataacaatgctgaggaggataacaagaagcttaaagaagaagtgcgcaaacttaaggaggagctggggtcagcaaggaaaaccctgcacaagtccgagagtgaggttgtggcaatcaagaagcagtgcgaaggcctaaccaaggagtatgaccggctgctggaagagcattctagactgcaggcacagtcagatggaccaaaggacaagaaagacgactgagtcagccatggataccccccaaaagcatccccagcagtgtcctgttgtgttctttccatggagcggttactacagagtgcatggcagtggcagaaagcactttttccagatgggctcttggcagtcattttttaaacatgtattctatttccagctaacggcaacagcactctgattggccttttcttctatcctctccctaatgctatctgtctgctttctgctccctcatcatagacagactgtaacatggacccccagccaagtcgcttacagccccccccccccccccaataacacttcttttctttcatgggtacagtgtattccttgtattctaaggatacatgagtggtttaagctaaagagggaagattcaattattttttcagggtttcagctacagaattgtgatttgagtgcaattagcgttccttgatttgcatgtctagccctccaccagcagcaagggagtcaataaacctggtttaaacaaaaaaaaaaaaaaaaaaaaa
Translation: MSLQWTAVATFLYVEVFLVLLLCIPFISPTRWQKIFKSRLVQLLVTYGNTFFLVLIAILVLLLLDAFREIQKYGVGEQVDLKNNPVAVEHIHMKLFRAQRNLYIAGFSLLLSFLLRRLVMLISKQATLLASNEAFRKQAESASDAAKKYMEENDKLKKELKSLGVEVSDLPDNNAEEDNKKLKEEVRKLKEELGSARKTLHKSESEVVAIKKQCEGLTKEYDRLLEEHSRLQAQSDGPKDKKDD
Donor tissue: neurula