ORFeome > c3orf37 – XORFeome 2.0

c3orf37 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chromosome 3 open reading frame 37, mRNA (cDNA clone MGC:75607 IMAGE:5379262), complete cds
Gene Symbol: c3orf37
Gene ID: 394754
ORF gb_acc: MG132774
ORF ID: 10088

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061596

Library Location

Plate ID: GDExt11002
Well Location: D04

EST Sequences

Clone: MGC:75607 IMAGE:5379262
Trimmed Sequence: ATGTGTGGGCGCACAGCATGCACTCTAGCACCAGATGATGTGAGGAAAGCTTGCACATATCGAGACAAGCAAGGAGGAAGGAAATGGCCGAATTGGAGGGATGGTGACTCGGACAAATACCAGCCATCTTATAACAAGAGTCCCCAGTCAAACAGCCCAGTTCTCTTATCTTTAAAGCATTTCCAGAAGGATGCAGATTCTTCTGAGCGAGTCCTTGCTGCGATGCGCTGGGGTCTTATTCCTTCATGGTTCAATGAGCCGGACCCATCAAAAATGCAATACAAAACAAACAACTGTCGGAGTGATACTATGACAGAAAAGGCTTTATATAAGGCTTCTCTGTTTAAAGGGAAACGCTGTGTTGTCCTTGCTGATGGATTTTATGAATGGCAGAGGCAGAATAGTGAAAAGCAGCCTTACTACATTTATTTTCCACAGATCAAAGCAGAAAAGTCTCCTGCTGAACAGGACATCACAGACTGGAATGGCCAGAGATTGCTTACCATGGCTGGACTGTTTGATTGTTGGGAACCCCCCAATGGAGGGGAGACCTTATACTCTTACACTGTTATCACAGTGGATTCTTCAAAAACCATGAACTGGATACATGACAGAATGCCAGCTATACTGGATGGAGATGAAGCAGTTAGGAAATGGCTGGATTTTGGGGAGGTTCCAACGAAAGATGCACTTAAACTCATCCATCCCATTGAAAACATAACTTACCATCCTGTTTCAACAGTAGTAAACAATTCCAGAAATAACACCCCGGAATGTATGGCTGCTATAATCCTCACCCAAAAAAAGGGTCCAGCATTAAGTGCCAGCAGCAAAAAGATGTTAGACTGGTTACAAAATAAATCCCCCAAGAAAGAAGAATCACACAGCATCCAATCGCCTAAATTGTCACAGTTTGGGGCGCCACCTAAGAAAACCAGTGCAGGATTGATGCAACAGTGGCTAAAGAAAGAAGATGGGGAGCCTTCACCAAAAAGAGCAAAGAAGTAA
Full Trace Sequence: tgctcgctgagggaaagtatcggagtgagtgtcctgtgtgggaagaagaatgtgtgggcgcacagcatgcactctagcaccagatgatgtgaggaaagcttgcacatatcgagacaagcaaggaggaaggaaatggccgaattggagggatggtgactcggacaaataccagccatcttataacaagagtccccagtcaaacagcccagttctcttatctttaaagcatttccagaaggatgcagattcttctgagcgagtccttgctgcgatgcgctggggtcttattccttcatggttcaatgagccggacccatcaaaaatgcaatacaaaacaaacaactgtcggagtgatactatgacagaaaaggctttatataaggcttctctgtttaaagggaaacgctgtgttgtccttgctgatggattttatgaatggcagaggcagaatagtgaaaagcagccttactacatttattttccacagatcaaagcagaaaagtctcctgctgaacaggacatcacagactggaatggccagagattgcttaccatggctggactgtttgattgttgggaaccccccaatggaggggagaccttatactcttacactgttatcacagtggattcttcaaaaaccatgaactggatacatgacagaatgccagctatactggatggagatgaagcagttaggaaatggctggattttggggaggttccaacgaaagatgcacttaaactcatccatcccattgaaaacataacttaccatcctgtttcaacagtagtaaacaattccagaaataacaccccggaatgtatggctgctataatcctcacccaaaaaaagggtccagcattaagtgccagcagcaaaaagatgttagactggttacaaaataaatcccccaagaaagaagaatcacacagcatccaatcgcctaaattgtcacagtttggggcgccacctaagaaaaccagtgcaggattgatgcaacagtggctaaagaaagaagatggggagccttcaccaaaaagagcaaagaagtaaccttacatacgggccaagctttggaaaggaaaataaaaccatacagatttgttcagttaaagacagtaggaagccactttcactgcattaaaggggacattaaggggacacatgccctaagtataatcgcattgctcagttctgttgctttggagggataggactgagctggaaagtgtccctctgcttcagtaagtgaaccttttgcacttcttcctggcccttgcctgggcacagcacagctaacacattttctagccagtgatagcaatgccatcctctcatttcttcttcaagtattttgtgcagttggggttatgttatgccaaccctgtgtttcagaaagaaggataagtttcagtattgtaaagttgtgacaaggttatcgatgcctggcaaatacacgagcccccagtactgtttctcttcctgcattcatttaaaggcccatggctttattacttgttgtacagagaggtaaatagaactacagacgcactgactcatttgtcaggggatctcatgcctatgaggctcattaaaattcagaactgttttgagaaaaaaaaaaaaaaaaa
Translation: MCGRTACTLAPDDVRKACTYRDKQGGRKWPNWRDGDSDKYQPSYNKSPQSNSPVLLSLKHFQKDADSSERVLAAMRWGLIPSWFNEPDPSKMQYKTNNCRSDTMTEKALYKASLFKGKRCVVLADGFYEWQRQNSEKQPYYIYFPQIKAEKSPAEQDITDWNGQRLLTMAGLFDCWEPPNGGETLYSYTVITVDSSKTMNWIHDRMPAILDGDEAVRKWLDFGEVPTKDALKLIHPIENITYHPVSTVVNNSRNNTPECMAAIILTQKKGPALSASSKKMLDWLQNKSPKKEESHSIQSPKLSQFGAPPKKTSAGLMQQWLKKEDGEPSPKRAKK
Donor tissue: tailbud