ORFeome > canx – XORFeome 2.0

canx – XORFeome 2.0

General Information

Species: Xenopus tropicalis calnexin, mRNA (cDNA clone MGC:69400 IMAGE:5335382), complete cds
Gene Symbol: canx
Gene ID: 448161
ORF gb_acc: MG133299
ORF ID: 10791

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074698

Library Location

Plate ID: GDExt11007
Well Location: F08

EST Sequences

Clone: MGC:69400 IMAGE:5335382
Trimmed Sequence: ATGGATCTGAAATGGTTTCTGTTAGTGACTCTTCTGGTGCATGGTTTAGCAACAATAAATGCGCATGGCGGGCACCATCATGACCACGATCATGACCATGACCATGATCACGACCACGATCACGATGAAGATGATGGGCTAGACATCGATGATGAACTAGAAGATCCTGAAGAATTAAAGCCAGAGACCAGCACACCGCCTCCTGCTCCTAAGGTGACTTACAAAGCCCCAGTACCAACAGGAGAAGTATATTTTTCAGAATCATTTGACAAAGGAACTTTGGATGGGTGGATTCTCTCCAAAGCCAAGAAAGATGACACAGACGAAGAGATTGCCAAGTATGATGGTAAATGGGAAGTATTAGAAATGAAAGATACAAAGCTCCCTGGAGACCTAGGTCTTGTCCTGATGTCACGTGCAAAACACCATGCAATTGCCAGCAAAATGAAGAAGCCCTTTGTCTTTGATAAGAAATCTCTAATTGTACAATATGAAGTTAATTTTCAAAATGGAATTGAATGTGGGGGAGCATATGTGAAACTACTTTCCAAGACTCCAGAACAGAAACCTGAGCAGTTCCATGATAAAACTCCCTACACTATCATGTTTGGCCCTGACAAGTGTGGTGAAGATTACAAACTGCACTTCATTTTCCGGCACAAGAACCCAAAGACTGGAGAATACGAGGAGAAACATGCAAAACGACCAGATGCAGACCTAAAATCTTACTTTACAGACAAAAAAACTCACCTTTACACCCTAGTCTTGAATCCTGACAACAGCTTCGAAATTCTAGTTGATCAAACTGTTGTAAACCGCGGGAATCTCCTTAATGACGTGAACCCTCCTGTGAATCCCCCTAATGAGATAGAAGATCCAGAGGATAAAAAGCCTGAAGATTGGGATGAGAGACCAAAAATACCAGATCCTGATGCTGTGAAACCTGATGACTGGGATGAGGATGCTCCTGCAAAGATCCCAGATGAAAATGCTGTCAAACCAGAAGGCTGGCTGGATGATGAACCTGAATACATTCCTGATCCAGATGCAGAGAAGCCAGAGGATTGGGATGAAGATATGGATGGGGAATGGGAGGCACCACAAGTGGCAAATCCTAAGTGCGAGTCTGCTCCCGGTTGTGGAGTGTGGCAACGTCCAACTATTGACAATCCCAGCTACAAAGGCAAATGGAAGCCTCCAATGATTGATAATCCAAACTATCAGGGTATATGGAAACCAAGAAAGATCCCAAATCCAGATTTCTTTGAAGATCTGGAACCATTCAGGATGACTCCATTCTACGCAGTTGGCCTTGAACTGTGGTCCATGACCTCTGATATTTTCTTTGACAATTTTATTGTGACCTCAGAGAAAAATGTGGCTGACGACTGGGCTAATGATGGATGGGGCCTGAAAAAGGCAGCTGATGGAGCATCTGCGCCCAGTGTGGTGGGACAAATGATGGCGGCTGCGGAGGAAAGGCCCTGGCTCTGGATTGTTTATATTCTGACTGTGGCTCTGCCAGTTTTTCTGGTCATTCTCTTCTGCTGCTCTGGAAAGAAACAGCCATTGGATGCAGAACACAAAAAGACAGATGCTCCACAGCCTGATGTAAAAGAGGAAGAGGAGGAGGATGAGGAGGAAGAAGGAAAGGCCAATAAGATTGAAGAGGAAGAGGATGCTGAAGAAAGTGAACCAAAGCAGGATGAAGCTGAAGATCAAGAAAGCCAAGAGGAAGAGGAGGCAGAAGAGGAGATTAAAACTAAGGAGGATGACATTATAAACAGATCTCCAAGAAATCGAAAACCTCGAAGAGATTAA
Full Trace Sequence: gggcttggagggcaccggagtgcggggcaggctgagtcactgtgatcatggatctgaaatggtttctgttagtgactcttctggtgcatggtttagcaacaataaatgcgcatggcgggcaccatcatgaccacgatcatgaccatgaccatgatcacgaccacgatcacgatgaagatgatgggctagacatcgatgatgaactagaagatcctgaagaattaaagccagagaccagcacaccgcctcctgctcctaaggtgacttacaaagccccagtaccaacaggagaagtatatttttcagaatcatttgacaaaggaactttggatgggtggattctctccaaagccaagaaagatgacacagacgaagagattgccaagtatgatggtaaatgggaagtattagaaatgaaagatacaaagctccctggagacctaggtcttgtcctgatgtcacgtgcaaaacaccatgcaattgccagcaaaatgaagaagccctttgtctttgataagaaatctctaattgtacaatatgaagttaattttcaaaatggaattgaatgtgggggagcatatgtgaaactactttccaagactccagaacagaaacctgagcagttccatgataaaactccctacactatcatgtttggccctgacaagtgtggtgaagattacaaactgcacttcattttccggcacaagaacccaaagactggagaatacgaggagaaacatgcaaaacgaccagatgcagacctaaaatcttactttacagacaaaaaaactcacctttacaccctagtcttgaatcctgacaacagcttcgaaattctagttgatcaaactgttgtaaaccgcgggaatctccttaatgacgtgaaccctcctgtgaatccccctaatgagatagaagatccagaggataaaaagcctgaagattgggatgagagaccaaaaataccagatcctgatgctgtgaaacctgatgactgggatgaggatgctcctgcaaagatcccagatgaaaatgctgtcaaaccagaaggctggctggatgatgaacctgaatacattcctgatccagatgcagagaagccagaggattgggatgaagatatggatggggaatgggaggcaccacaagtggcaaatcctaagtgcgagtctgctcccggttgtggagtgtggcaacgtccaactattgacaatcccagctacaaaggcaaatggaagcctccaatgattgataatccaaactatcagggtatatggaaaccaagaaagatcccaaatccagatttctttgaagatctggaaccattcaggatgactccattctacgcagttggccttgaactgtggtccatgacctctgatattttctttgacaattttattgtgacctcagagaaaaatgtggctgacgactgggctaatgatggatggggcctgaaaaaggcagctgatggagcatctgcgcccagtgtggtgggacaaatgatggcggctgcggaggaaaggccctggctctggattgtttatattctgactgtggctctgccagtttttctggtcattctcttctgctgctctggaaagaaacagccattggatgcagaacacaaaaagacagatgctccacagcctgatgtaaaagaggaagaggaggaggatgaggaggaagaaggaaaggccaataagattgaagaggaagaggatgctgaagaaagtgaaccaaagcaggatgaagctgaagatcaagaaagccaagaggaagaggaggcagaagaggagattaaaactaaggaggatgacattataaacagatctccaagaaatcgaaaacctcgaagagattaagaaaacaaatatatattaaaaatccaccaatgaacttggacacttggcagaagttaatataaagagctttctgtttctacagagatgaaagaaaactatccaggaacatcgtaacactgaagccacgatacattgtcacccacaagtcgcagctgagaactaaaccacgtgtctagatacccaagtaatgaaagaaaagcaacattcctgtaatctcaatgcatttaatactagttgacttcttggtgggatgtgcagtgtaacatgaagaactaactgtactgtttttcttttgttttttgtttgtttttttttttttaaattaaaactttttaaaaggagaagaaatctagtattgccaaactcttccatacttcagtgtaatgaaacgtattaatcctagaaaataaagtcagaggagagctttaggaaatgtaagatctaaaatgcattttttatttgtttaatggcttcttggtttgctgtttccactccttcaagtttaaagtaacccatcttgctgttcatgggacatatctttttttttttttttttttttttgttttactccccgttttacacaagtgttttcaatacaggctttggttctagagagcatggtcagtagtgctgacaacatgcatgttatccctggttattgttaagccgccagcacttgaagtctttatggaccaaaatgctagaattacctggtaaacagatgtcccggatacttctcacttccatgtgtgctcccaagtgtaaatatatccatatgcaactttccctttgtgttcatactgggttttacagaagttgacagtccctggtttgtttgttttttgtcttttcactgaaactctgtttccacatctttatttaaagcaactttgctgtttaatcagtgttagtctttttctgtgatttgcttactagcagaattggatactcccaaattggcatgaatgcctgcatattctctccaggtcacaaacagtgcagttcttgcatggacctgtctcgtaagacactaacactttgtctgtagtatgggcctgagcgcaagcggttttctagtgtatttttgacttcctttgcagaaaaaggttaatgacaggtggtagctggcctctgtttgctagaaattctcttgaagagaaacctcttttaatgtcaggaatatacgaatataattttttcaacacagacatacctaattccacagataaaaagaaaaccattatagtctgcctgtgctgcagcgactagattcctttgttccaatgtgaagtgatggattctgggacttgaagtccatctgctttccagagaatctgtgcacaaccaggggtgtaactacaaaggaagcagaccctgtgtttgcagggggacccaggagtgtagggggggcagaagggccctaatgtgcaatttcaatatatcttggtagaataggtcaacttgccaatattttggagccctaaattgagccacccgcttgctatggaaagcagaggaacctcaagccccaggatcgaacatttcacaatgggacaatggaggggttgcatcacacggtcagggaatggtttgtcggtgacacaaataaaggggtttcccattaacacttgtaatgccagctgtacaatgaaatgcagacagccaggtactttacagccagtgcctaagcttcttctctttatagcacagtaaggcaaccttggagacagtccttgtggctttgtctgcttgtcttgctgagaaatcaaggagaccaaaattacaacttgctgttgccatataatgattattttaaagtccacttgtcaaattgcatatgtatttctttggtcaaatcttcagtgctgattgagttgttagacggcctggcccttttggggtagttgacaaataatacctgttatatattttcattgcctaaatgacacattcttctactgatcactttgtaaatgaatgattttattcagccattttcctcggtaccatgtcatgctatgttcttgcatatgcattggctctcatagctacaattgcgggaagcaaaatctgattttctctgtgatttggaatttgttaaccttgtatactagactggtaactgaacaatagactcgtgtaacaggctggtatggttggagcaaataattagacccccagatgtgagatggaaagagggttcatggttgttcagcgctgatacaggctaatgctagatttaggaacaattcttttctgacttgatttcttcctggtttgaatcccccataactgctttttaaatttctttctctttgctatagattgattatatttcccttgctatttccaaacaaaatgactgcttggggtgcactaaggcatttcttttctttgcctgtcccagtggcactactgcatgagtaaaactctcctaagccaaggatgaatgctgcagcagtgttttgatggcacaagctatgatgaaaaaaaaaatatgtattttatttgctggcaggccttcaacttactgtaatgtgtaaagtcttttaatttgctcttgttgtggcaacgtaaattatattgttcatgtagggtttcagagtcagaacacaataaaatttttaagaaaaaaaaaaaaaaaa
Translation: MDLKWFLLVTLLVHGLATINAHGGHHHDHDHDHDHDHDHDHDEDDGLDIDDELEDPEELKPETSTPPPAPKVTYKAPVPTGEVYFSESFDKGTLDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAADGASAPSVVGQMMAAAEERPWLWIVYILTVALPVFLVILFCCSGKKQPLDAEHKKTDAPQPDVKEEEEEDEEEEGKANKIEEEEDAEESEPKQDEAEDQESQEEEEAEEEIKTKEDDIINRSPRNRKPRRD
Donor tissue: tailbud