ORFeome > casq1 – XORFeome 2.0

casq1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis calsequestrin 1, mRNA (cDNA clone MGC:75720 IMAGE:5380877), complete cds
Gene Symbol: casq1
Gene ID: 394489
ORF gb_acc: MG132921
ORF ID: 10287

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059743

Library Location

Plate ID: GDExt11003
Well Location: A08

EST Sequences

Clone: MGC:75720 IMAGE:5380877
Trimmed Sequence: ATGAAGGGGCCGTGGCTGGTTCTGGCAGCTCTGTGCCTCGCCCTGGCAAACCTGGGTGCCCGGGCAGAGGAAGGGCTAGATTTTCCCGAGTATGATGGAGAGGACCGAGTAATCAACATCAACCTCAAAAACTACAAGGCCGCCCTGAAAAAGTACGAAGTGTTAGCCTTGCTGTACCATGAACCAATTGAGGATGACAAGGCTTCCCAAAGGCAATTTGAGATGGAAGAGCTGATCTTTGAGTTAGCTGCCCAAGTCCTGGAAGATAAAGGTGTGGGATTTGGCTTAGTCGACTCTGAAAAAGATGCCGCTGTGGCCAAAAAATTAGGACTGGATGAAGAAGACAGTATCTACGTATTCAAAGATGACGAGGTTATCGAATATGATGGGGAATTTTCTGCAGATACTCTGGTGGAATTCCTGCTGGATGTGCTTGAAGACCCTGTAGAGTTTATTGAGGGAAGTCACGAACTTGCCGCATTCGAAAACATCGAAGAGGATCAAAAGCTCATTGGATACTTCAAAAATGAAGACTCTGAACATTACAAGGCCTTCGTAGACGCAGCGGAGGAGTTTCACCCCTACATCCCATTCTTCGCTACTTTCGACAGCAAGGTTGCTAAGAAACTGGACCTCAAGATCAATGAAATTGACTACTATGAACCTTTCCATGATGAGCCCGTCACAATCCCCAACAAGCCCAACAGTGAAGAAGAAATTGTAGACTTCATGCACTTACACAAGAGACCAACACTGAGGAAGCTGAAGCCTGACAGTATGTATGAAACTTGGGAAGATGATTTGGATGGTATTCACATTGTTGCATTCGCTGAAGAGGATGACCCCGATGGTTATGAGTTCCTGGAAATCATCAAAGAAGTTGCAGAAGACAACCGTGGCTAA
Full Trace Sequence: ggcagctgcaccccaagtccccagtgagagaggagctgacccaccaagaaccagggacctctacctaaaagggtggagaagggatttttttttcttttatcttcccaccccctttgattttgatttaaattggacttctcagggggacctgttgacttggaacgtgcgagaggatgaaggggccgtggctggttctggcagctctgtgcctcgccctggcaaacctgggtgcccgggcagaggaagggctagattttcccgagtatgatggagaggaccgagtaatcaacatcaacctcaaaaactacaaggccgccctgaaaaagtacgaagtgttagccttgctgtaccatgaaccaattgaggatgacaaggcttcccaaaggcaatttgagatggaagagctgatctttgagttagctgcccaagtcctggaagataaaggtgtgggatttggcttagtcgactctgaaaaagatgccgctgtggccaaaaaattaggactggatgaagaagacagtatctacgtattcaaagatgacgaggttatcgaatatgatggggaattttctgcagatactctggtggaattcctgctggatgtgcttgaagaccctgtagagtttattgagggaagtcacgaacttgccgcattcgaaaacatcgaagaggatcaaaagctcattggatacttcaaaaatgaagactctgaacattacaaggccttcgtagacgcagcggaggagtttcacccctacatcccattcttcgctactttcgacagcaaggttgctaagaaactggacctcaagatcaatgaaattgactactatgaacctttccatgatgagcccgtcacaatccccaacaagcccaacagtgaagaagaaattgtagacttcatgcacttacacaagagaccaacactgaggaagctgaagcctgacagtatgtatgaaacttgggaagatgatttggatggtattcacattgttgcattcgctgaagaggatgaccccgatggttatgagttcctggaaatcatcaaagaagttgcagaagacaaccgtggctaagatgtatcttaccaaataaacagtttaaaaacaaaaaaaaaaaaaaa
Translation: MKGPWLVLAALCLALANLGARAEEGLDFPEYDGEDRVININLKNYKAALKKYEVLALLYHEPIEDDKASQRQFEMEELIFELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLDEEDSIYVFKDDEVIEYDGEFSADTLVEFLLDVLEDPVEFIEGSHELAAFENIEEDQKLIGYFKNEDSEHYKAFVDAAEEFHPYIPFFATFDSKVAKKLDLKINEIDYYEPFHDEPVTIPNKPNSEEEIVDFMHLHKRPTLRKLKPDSMYETWEDDLDGIHIVAFAEEDDPDGYEFLEIIKEVAEDNRG
Donor tissue: tadpole