ORFeome > cbx5 – XORFeome 2.0

cbx5 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chromobox homolog 5 (HP1 alpha homolog, Drosophila), mRNA (cDNA clone MGC:76213 IMAGE:5336204), complete cds
Gene Symbol: cbx5
Gene ID: 394502
ORF gb_acc: MG132806
ORF ID: 10151

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061619

Library Location

Plate ID: GDExt11002
Well Location: C06

EST Sequences

Clone: MGC:76213 IMAGE:5336204
Trimmed Sequence: ATGGGAAAAAAGAACAAAAGAGCATCAGATGCCTCCTCTTCCTCTGAGGAAGAAGAGTATGTTGTGGAAAAGGTTCTCGATCGAAGAGTGGTAAAGGGACAAGTAGAATTCCTTCTAAAGTGGAAAGGCTTCTCAGAGGAACACAACACGTGGGAGCCAGATAGAAACCTAGATTGTCCAGAACTTATCTCTGAGTTTATGAAGAAGTACAAGAAAGTTAAGGAGACTGACCCAAAAGCCAAGACGGAGAGCACCAAAAGGAAAGCTGGAAGCGATGACATTAAGGCGAAGAAAAGGAGAGAGAGCAATGACATTGCACGGGGCTTTGAAAGAGGCTTGGAGCCAGAAAAGATCATTGGCGCTACAGATTCTTGTGGCGAGCTGATGTTTCTTATGAAATGGAAAGACTCTGATGAAGCTGACCTTGTGCTGGCTAAGGAAGCCAATGTGAAATGCCCACAGATCGTTATAGCATTTTATGAAGAGAGACTGACTTGGCACGCCTATCCCGAAGAGTCGGAAAGCAAAGAGAAGGAAGCCGTTAAAAGCTAA
Full Trace Sequence: cggggtttggtcgctggctgcgcacagtaccgctcggtaagagccttcactcaattcctgctagcgagcagctttcggtgggcgcacggtgtatttcgcgcaggaagataatggacatcagtgacactcctacaggtcctaggcccaatagggagggcacaatgggaaaaaagaacaaaagagcatcagatgcctcctcttcctctgaggaagaagagtatgttgtggaaaaggttctcgatcgaagagtggtaaagggacaagtagaattccttctaaagtggaaaggcttctcagaggaacacaacacgtgggagccagatagaaacctagattgtccagaacttatctctgagtttatgaagaagtacaagaaagttaaggagactgacccaaaagccaagacggagagcaccaaaaggaaagctggaagcgatgacattaaggcgaagaaaaggagagagagcaatgacattgcacggggctttgaaagaggcttggagccagaaaagatcattggcgctacagattcttgtggcgagctgatgtttcttatgaaatggaaagactctgatgaagctgaccttgtgctggctaaggaagccaatgtgaaatgcccacagatcgttatagcattttatgaagagagactgacttggcacgcctatcccgaagagtcggaaagcaaagagaaggaagccgttaaaagctaaaattcactttaaccatcccgtatatactccctccttcatgcagacacacacgcacacactcacagtctacctacactccttacctgccccagtcaagggcaaaaacgttttttttttaataaaaacagaaataagcctgtggcctctgaaacaagcctgcaagtggaatttgcacatgaccgtggcagccattaaaagtttcagtggtggcgtattcctagtgaggcactgtaggtgtccgttacagtggattcattctcttgcacagaggcagaagccagcaacttcttaaaggagaccataggcctctgcagtgtttctaatgaggtgcccaaggctttaccagtggttacatttttgtgttcggctcagaacagcttcggcgcattgatagaagaacttctgtcatataatggtaatgattctgtgtgctgtgaagggatccttgctgcttactcccattcttggacacttgttcttggagggagaagactttgttttttttgttttaaatattgttttaatatatatcatctgtactcattaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGKKNKRASDASSSSEEEEYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNLDCPELISEFMKKYKKVKETDPKAKTESTKRKAGSDDIKAKKRRESNDIARGFERGLEPEKIIGATDSCGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEESESKEKEAVKS
Donor tissue: tailbud