ORFeome > cbx5 – XORFeome 2.0

cbx5 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chromobox homolog 5 (HP1 alpha homolog, Drosophila), mRNA (cDNA clone MGC:89578 IMAGE:6994184), complete cds
Gene Symbol: cbx5
Gene ID: 394502
ORF gb_acc: MG134379
ORF ID: 12068

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC084904

Library Location

Plate ID: GDExt11020
Well Location: D04

EST Sequences

Clone: MGC:89578 IMAGE:6994184
Trimmed Sequence: ATGGGAAAAAAGAACAAAAGAGCATCAGATGCCTCCTCTTCCTCTGAGGAAGAAGAGTATGTTGTGGAAAAGGTTCTCGATCGAAGAGTGGTAAAGGGACAAGTAGAATTCCTTCTAAAGTGGAAAGGCTTCTCAGAGGAACACAACACGTGGGAGCCAGATAGAAACCTAGATTGTCCAGAACTTATCTCTGAGTTTATGAAGAAGTACAAGAAAGTTAAGGAGACTGACCCAAAAGCCAAGACGGAGAGCACCAAAAGGAAAGCTGGAAGCGATGACATTAAGGCGAAGAAAAGGAGAGAGAGCAATGACATTGCACGGGGCTTTGAAAGAGGCTTGGAGCCAGAAAAGATCATTGGCGCTACAGATTCTTGTGGCGAGCTGATGTTTCTTATGAAATGGAAAGACTCTGATGAAGCTGACCTTGTGCTGGCTAAGGAAGCCAATGTGAAATGCCCACAGATCGTTATAGCATTTTATGAAGAGAGACTGACTTGGCACGCCTATCCCGAAGAGTCGGAAAGCAAAGAGAAGGAAGCCGTTAAAAGCTAA
Full Trace Sequence: cgcacggtgtatttcgcgcaggaagataatggacatcagtgacactcctacaggtcctaggcccaatagggagggcacaatgggaaaaaagaacaaaagagcatcagatgcctcctcttcctctgaggaagaagagtatgttgtggaaaaggttctcgatcgaagagtggtaaagggacaagtagaattccttctaaagtggaaaggcttctcagaggaacacaacacgtgggagccagatagaaacctagattgtccagaacttatctctgagtttatgaagaagtacaagaaagttaaggagactgacccaaaagccaagacggagagcaccaaaaggaaagctggaagcgatgacattaaggcgaagaaaaggagagagagcaatgacattgcacggggctttgaaagaggcttggagccagaaaagatcattggcgctacagattcttgtggcgagctgatgtttcttatgaaatggaaagactctgatgaagctgaccttgtgctggctaaggaagccaatgtgaaatgcccacagatcgttatagcattttatgaagagagactgacttggcacgcctatcccgaagagtcggaaagcaaagagaaggaagccgttaaaagctaaaattcactttaaccatcccgtatatactccctccttcatgcagacacacacgcacacactcacagtctacctacactccttacctgccccagtcaagggcaaaaacgttttttttttaataaaaacagaaataagcctgtggcctctgaaacaagcctgcaagtggaatttgcacatgaccgtggcagccattaaaagtttcagtggtggcgtattcctagtgaggcactgtaggtgtccgttacagtggattcattctcttgcacagaggcagaagccagcaacttcttaaaggagaccataggcctctgcagtgtttctaatgaggtgcccaaggctttaccagtggttacatttttgtgttcggctcagaacagcttcggcgcattgatagaagaacttctgtcatataatggtaatgattctgtgtgctgtgaagggatccttgctgcttactcccattcttggacacttgttcttggagggagaagactttgttttttttgttttaaatattgttttaatatatatcatctgtactcattgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGKKNKRASDASSSSEEEEYVVEKVLDRRVVKGQVEFLLKWKGFSEEHNTWEPDRNLDCPELISEFMKKYKKVKETDPKAKTESTKRKAGSDDIKAKKRRESNDIARGFERGLEPEKIIGATDSCGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEESESKEKEAVKS
Donor tissue: neurula