ORFeome > cdc16 – XORFeome 2.0

cdc16 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cell division cycle 16 homolog, mRNA (cDNA clone MGC:88902 IMAGE:6998770), complete cds
Gene Symbol: cdc16
Gene ID: 448547
ORF gb_acc: MG134056
ORF ID: 11675

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076877

Library Location

Plate ID: GDExt11016
Well Location: H10

EST Sequences

Clone: MGC:88902 IMAGE:6998770
Trimmed Sequence: ATGAACCTGGACCGTCTGAGAAAGCGAGTCCGGCAGTACATAGAGCAGCAACAATACCAAAGTGCACTCTTTTGGGCTGATAAAGTTGCTTCCTTGTCACATGAAGAGCCACAGGATATTTACTGGCTGGCACAATGTCTCTACTTAACTGCTCAGTATCATAGGGCATCTCATGCTTTAAGGTCACGTAAACTGGACAAAGTACATGAGGCATGCAGATACCTTGCAGCACGTTGTCATTATGCTGCAAAAGAGTACCAGCAAGCTCTGGATATACTTGATATGGAAGAACCAATCAACAAGAAATTATTTGAGAGGAGTCTGAAAGAAGATCTAAAGGAGCCATCAGGAGAATGGCAGATGTCACAGTCTTCGATCAAGAGCTCCATTTGTCTTTTGCGAGGGAAGATCTATGATGCCTTAGATAACAGAACTTTAGCAACTTACAGCTACAAAGAAGCCTTGAAGTTTGATGTTTACTGCTTTGAAGCATTTGACCTCCTAACAGCTCATCATATGTTAACAGCACAAGAAGAAAAAGAACTTCTTGATTCTCTACCTCTTAGTAAAAAGTGCTCAGAAGATCAGGAATTGCTTCGTTTCCTCTACGAGAACAAATTAAAAAAGTACAATAAGCCCAGTGAAACTGTAATTCCAGAATCTGCAGATGGACTTCAGGAAAATCTTGATGTTGTTGTATCTTTAGCTGAAAGACATTATTACAACTGTGACTTCAAAATGTGTTACAAACTTACATCAGTAGTAATGGATAAAGACCCTTTTCATGCAAATTGCTTACCTGTTCATATTGGCACTCTAGTAGAACTGAACAAAGCAAATGAACTTTTCTATCTTTCCCATAAATTAGTGGATTTATATCCAAACAATCCTGTGTCCTGGTTTGCAGTGGGTTGCTATTATCTCATGGTTGGACACAAAAATGAACATGCCCGGAGGTATCTCAGCAAAGCAACTGCATTAGAAAGAAGCTATGGCCCTGCATGGATAGCATATGGACATTCATTTGCTGTAGAGAGTGAACATGACCAGGCTATGGCTGCATACTTTACAGCTGCACAGCTAATGAAAGGGTGTCACTTGCCCATGCTCTATATTGGATTAGAATATGGCTTGACCAATAACTCAAAACTAGCAGAGCGATTTTTCAGCCAAGCTTTGAGTATTGCCCCCGAGGACCCATTTGTTATGCACGAAGTTGGGGTAGTGGCATTTCAGAATGGAGACTGGAAGACTGCTGAGAAATGGTTCTTGGATGCTTTAGAAAAAATCCGAGTCATTGGAGATGAGGTAACTGTGGATAAATGGGAGCCACTGCTTAATAATCTGGGTCATGTACTAAGAAAACTTAAGAAGTATGATGAAGCCTTGGAGTATCATCGACAAGCTCTCGTGCTTATACCACAAAATGCTTCCACTTACTCTGCTATTGGATATATACACAGCCTAATGGGAAATTTTGAGAGTGCTATTGATTATTTTCACACTGCCCTTGGACTCAGGAGAGATGATACATTTTCAGTCACAATGCTTGGACATTGTATAGAAATGTATATTGGTGACTCTGAAGCCTATATTGGAACGGAAATTAAAGACAAGTTAAGGTGTTATGACTTTGATGTTCACACAATGAAAACCCTAAAAAATATAATTTCACCCCCCTGGGAAGAGAAAGACTTTGATTTTGAACGTCAGTCCCTTGATGAAAGTGGTATTATGGCTTTGGACACTTCTTATCTTCTACCCAAATCCTCTGACACCAGATCCCCAATAGAAGAAGCACTTGAAATTGAAATGAATGAGAGTGATATGATGTTGGAAACCTCCATGTCTGATCATAGCACATGA
Full Trace Sequence: gtcattgctccggtgaaaatgtcagcgttagtcattagtgtgtttggggtgtagaaagggatctgagctggtgaagactcgggaacgcgaccccaaatcgcccgtacagatttttgcagccagatcgtggggagcggggacgcgcacagaactcggaagcgtgctctctagtaggcttgcgcgtacgcgcttccgcggcatttccattgaataaaatgaacctggaccgtctgagaaagcgagtccggcagtacatagagcagcaacaataccaaagtgcactcttttgggctgataaagttgcttccttgtcacatgaagagccacaggatatttactggctggcacaatgtctctacttaactgctcagtatcatagggcatctcatgctttaaggtcacgtaaactggacaaagtacatgaggcatgcagataccttgcagcacgttgtcattatgctgcaaaagagtaccagcaagctctggatatacttgatatggaagaaccaatcaacaagaaattatttgagaggagtctgaaagaagatctaaaggagccatcaggagaatggcagatgtcacagtcttcgatcaagagctccatttgtcttttgcgagggaagatctatgatgccttagataacagaactttagcaacttacagctacaaagaagccttgaagtttgatgtttactgctttgaagcatttgacctcctaacagctcatcatatgttaacagcacaagaagaaaaagaacttcttgattctctacctcttagtaaaaagtgctcagaagatcaggaattgcttcgtttcctctacgagaacaaattaaaaaagtacaataagcccagtgaaactgtaattccagaatctgcagatggacttcaggaaaatcttgatgttgttgtatctttagctgaaagacattattacaactgtgacttcaaaatgtgttacaaacttacatcagtagtaatggataaagacccttttcatgcaaattgcttacctgttcatattggcactctagtagaactgaacaaagcaaatgaacttttctatctttcccataaattagtggatttatatccaaacaatcctgtgtcctggtttgcagtgggttgctattatctcatggttggacacaaaaatgaacatgcccggaggtatctcagcaaagcaactgcattagaaagaagctatggccctgcatggatagcatatggacattcatttgctgtagagagtgaacatgaccaggctatggctgcatactttacagctgcacagctaatgaaagggtgtcacttgcccatgctctatattggattagaatatggcttgaccaataactcaaaactagcagagcgatttttcagccaagctttgagtattgcccccgaggacccatttgttatgcacgaagttggggtagtggcatttcagaatggagactggaagactgctgagaaatggttcttggatgctttagaaaaaatccgagtcattggagatgaggtaactgtggataaatgggagccactgcttaataatctgggtcatgtactaagaaaacttaagaagtatgatgaagccttggagtatcatcgacaagctctcgtgcttataccacaaaatgcttccacttactctgctattggatatatacacagcctaatgggaaattttgagagtgctattgattattttcacactgcccttggactcaggagagatgatacattttcagtcacaatgcttggacattgtatagaaatgtatattggtgactctgaagcctatattggaacggaaattaaagacaagttaaggtgttatgactttgatgttcacacaatgaaaaccctaaaaaatataatttcacccccctgggaagagaaagactttgattttgaacgtcagtcccttgatgaaagtggtattatggctttggacacttcttatcttctacccaaatcctctgacaccagatccccaatagaagaagcacttgaaattgaaatgaatgagagtgatatgatgttggaaacctccatgtctgatcatagcacatgagtctagccatgcctcagatacggtcacactgcactgtgcaagtcccctcttgaggattatttcaggatctctgggggattacccctagttatggaagacagagctaaaacttctgaccataactggtcttctaatgtgcacggatggcttctctggcagtggataccaataactttacaaagagtttttcattttactgctaaatataggaggcatacatttcatattttttttttaacattttaatgtattcatgaacagctattatgactgtataaactgtcacaaaaattacatgtctgaatgttgagcatgtgaccatcaatagtctgatgtattaatgcaggagctttttttgtattgaaacatgatgcagcctactccagatgaaatgtgaaattaattaaaggccatattatttgtgataaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHALRSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFERSLKEDLKEPSGEWQMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEKELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETVIPESADGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMDKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSWFAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAEKWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTYSAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGTEIKDKLRCYDFDVHTMKTLKNIISPPWEEKDFDFERQSLDESGIMALDTSYLLPKSSDTRSPIEEALEIEMNESDMMLETSMSDHST
Donor tissue: