ORFeome > cdc34 – XORFeome 2.0

cdc34 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cell division cycle 34 homolog, mRNA (cDNA clone MGC:69351 IMAGE:5309200), complete cds
Gene Symbol: cdc34
Gene ID: 448013
ORF gb_acc: MG133293
ORF ID: 10784

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074529

Library Location

Plate ID: GDExt11008
Well Location: C01

EST Sequences

Clone: MGC:69351 IMAGE:5309200
Trimmed Sequence: ATGGCCCGGCCGGTGGCGCCGGTGCCCAGCTCTCAGAAGGCCTTGATGCTGGAACTCAAGGGGCTACAGGAAGAGCCGGTGGAGGGGTTCCGGGTCACCCTGGTAGATGAGGGGGATCTGTACAACTGGGAGGTGGCAATCTTTGGCCCCCCAAACACCCTCTATGAGGGGGGGTACTTCAAGGCCCGCTTAAAATTTCCAGTTGATTACCCCTACTCTCCTCCTGCGTTTCGTTTTTTGACAAAGATGTGGCATCCTAACATCTATGAGAATGGTGATGTATGTATTTCAATCCTGCATCCTCCAGTGGATGACCCACAAAGTGGAGAGCTACCTTCTGAAAGATGGAATCCTACCCAGAATGTGAGAACAATCCTGCTTAGTGTCATCTCCCTGTTGAATGAGCCTAACACTTTCTCTCCAGCAAATGTGGATGCATCTGTTATGTACAGAAAATGGAAGGACAGTAAAGGACGTGATAAAGAGTACACAGACATTATCAGGAAGCAGGTTGTGTCAACTAAGGCTGATGCTGAACATGATGGAGTGAAGGTTCCTACTACTCTGGCTGAATATTGTGTAAAGACCAAGGCTCCCGCTCCAGATGAAGGTTCGGACCTCTTCTATGATGACTACTATGATGATGATGAAATGGAGGAAGATGAGGACAGCTGCTATGAAGGCCAGGATGACTCTGGCAATGAGGAATCTTGA
Full Trace Sequence: cgcaaagcggctccgttgtgccgtaacatgtcgtaataaagcctttagtcgtctagcagccccttcttgctaaaacaccaaaagcctactgatcccatcctgccctacgcggaggacgctgtgggctcctggttagaaagcggggagcggaactaccatggcccggccggtggcgccggtgcccagctctcagaaggccttgatgctggaactcaaggggctacaggaagagccggtggaggggttccgggtcaccctggtagatgagggggatctgtacaactgggaggtggcaatctttggccccccaaacaccctctatgagggggggtacttcaaggcccgcttaaaatttccagttgattacccctactctcctcctgcgtttcgttttttgacaaagatgtggcatcctaacatctatgagaatggtgatgtatgtatttcaatcctgcatcctccagtggatgacccacaaagtggagagctaccttctgaaagatggaatcctacccagaatgtgagaacaatcctgcttagtgtcatctccctgttgaatgagcctaacactttctctccagcaaatgtggatgcatctgttatgtacagaaaatggaaggacagtaaaggacgtgataaagagtacacagacattatcaggaagcaggttgtgtcaactaaggctgatgctgaacatgatggagtgaaggttcctactactctggctgaatattgtgtaaagaccaaggctcccgctccagatgaaggttcggacctcttctatgatgactactatgatgatgatgaaatggaggaagatgaggacagctgctatgaaggccaggatgactctggcaatgaggaatcttgacattgtttgttcttccactatgcacctaccacctcttgggccccttgctcattaatgcaacattcaggatttatttttcacctttaatttacctggtctgcaagataccatggacatgactgctaaagcgtaataaagtccccttatgtgtaaacagagttctggagtgaaagggagggttttttttatatcttccctttttgcaaaaacgtctcaagagctgctgtagagaggggtgtctgaactgctgcagttcaagcttgcgccacaggttggcagtagacttcagcaagtcctgctgtactgactgcccttgttttcaattatactggttgcagagcagagcttgaattaaaggcactggtgggtggatatatatttggaaggcttatagagtggatgctatagctgcaatgtttttttctgctattctgggcttgtcactcacactgtgcatttactgactggatttttttatgtggcagatgattggaagggatagtgggttattgtgtgactttttcttttcatttttgtttctctgcagggtttcttgtttggttatttaataataaattctgaaaagtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MARPVAPVPSSQKALMLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTLYEGGYFKARLKFPVDYPYSPPAFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKDSKGRDKEYTDIIRKQVVSTKADAEHDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYDDDEMEEDEDSCYEGQDDSGNEES
Donor tissue: gastrula