ORFeome > cdk2ap1 – XORFeome 2.0

cdk2ap1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cyclin-dependent kinase 2 associated protein 1, mRNA (cDNA clone MGC:146912 IMAGE:7876524), complete cds
Gene Symbol: cdk2ap1
Gene ID: 549484
ORF gb_acc: MG135721
ORF ID: 13850

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC121523

Library Location

Plate ID: GDExt11037
Well Location: E10

EST Sequences

Clone: MGC:146912 IMAGE:7876524
Trimmed Sequence: ATGTCTTACAAGCCCAACCCGAACGCCCAGCACCCCGTCAGCAACCCCGGCTTGCAGGCTGGAAGTGCTCACTCCCCTTCGACAAGTATGGCATCGACTGCACAGTACAGGCAGCTAGTTAATGACTACGGACCTCCATCTTTAGGATATACACAGGTTTCTAATAGTAACCAGGTACCTCAGAGCAAGTATGCAGAGCTTCTTGCCATAATTGAAGAGCTGGGTAAAGAAATTAGACCAACATATGCTGGCAGTAAAAGTGCTATGGAGAGACTTAAAAGAGGTATCATCCACGCTAGGGGCTTGGTGCGGGAATGTTTGGCAGAAACAGAGCGTAATGCCAGATCCTAG
Full Trace Sequence: gagattcctcccctctcggcggcggtcatgtctctgggaatgtcttacaagcccaacccgaacgcccagcaccccgtcagcaaccccggcttgcaggctggaagtgctcactccccttcgacaagtatggcatcgactgcacagtacaggcagctagttaatgactacggacctccatctttaggatatacacaggtttctaatagtaaccaggtacctcagagcaagtatgcagagcttcttgccataattgaagagctgggtaaagaaattagaccaacatatgctggcagtaaaagtgctatggagagacttaaaagaggtatcatccacgctaggggcttggtgcgggaatgtttggcagaaacagagcgtaatgccagatcctagctctgccatgtcccaccgttataaagccaacagctatttctttttggatttgtgaaaccgccagagtggtctttctgcaaaccagatgggttcatcagatgcattttgaagaatttttgttcaaaagctgctgaagacaaaataaaatttttacatataaacagagttttcactgaaaagagttattactggctcttttctcttttttcagtgagtgcatggattctactacattgcttataagttacaatatatttacattttattcttgtacattaacacaagctgagtcctaccaatttaaaaccattcaatttgtgttctaaggacattgcatgacttcttttgcctatagatttgtgtttgatatcatcttgtaatctactccattgactgtaatccttcatagttttcaacagactatcatgtcataagacatatttgcagcacctgaaaggtctgagaatgtttgttttttttccagtcactgatgtcacttttctgggacaagattctctgatatatggagtctgcaaaatctttaaaagtgcccaaacaaacggtagactagtcatgtttatttttggttagaaatttagggaaatattaaaaagggagtatattactggcctatgcacttgcacgtctgtaaacatatttgctaaccactcaacatgcatgatttatttaaaggaaaaatgagaaattttacttttctacaggtggatctaggtatctgccgtaactgcaattaatatacacataaaggctgtgttggaaaaaatgaaaactaacaatttgcatctttgtatgtatttattacttgatgtaataaagcttattttcactaaaaaaaaaaaaaaaaaa
Translation: MSYKPNPNAQHPVSNPGLQAGSAHSPSTSMASTAQYRQLVNDYGPPSLGYTQVSNSNQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Donor tissue: skin