ORFeome > cdk9 – XORFeome 2.0

cdk9 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cyclin-dependent kinase 9, mRNA (cDNA clone MGC:69296 IMAGE:5308541), complete cds
Gene Symbol: cdk9
Gene ID: 448039
ORF gb_acc: MG133234
ORF ID: 10707

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074560

Library Location

Plate ID: GDExt11006
Well Location: E09

EST Sequences

Clone: MGC:69296 IMAGE:5308541
Trimmed Sequence: ATGGCCAAGAACTACGACTCGGTGGAATTCCCTTACTGTGATGAGGTCTCCAAGTACGAGCGGCTCGCCAAGATCGGCCAGGGCACCTTCGGGGAAGTGTTCAAGGCCAAACATCGACAGACGGGGAAGAAAGTGGCACTTAAAAAAGTTCTGATGGAAAACGAGAAGGAAGGGTTCCCTATCACGGCTCTGCGAGAGATAAAAATCCTGCAGCTGCTGAAACACGAGAACGTAGTTAACCTCATAGAGATCTGTCGGACAAAAATTTCTCCCACAGCCAACCAGTACAATAGATGCAAAGGAACTATTTTCCTGGTGTTCGACTTTTGTGAGCATGATCTAGCAGGCTTGCTGAGCAATGCTCATGTCAAGTTCACGCTCTCCGAGATCAAGAAGGTAATGCAAATGCTGCTCAACGGCCTCTACTACATTCACCGGAACAAGATCCTGCACAGAGACATGAAGGCAGCAAACGTACTGATCACCAGGGACGGAGTGTTGAAACTTGCAGACTTTGGGCTTGCCAGAGCATTCAGCCTTGCCAAGAACAGCCAGCCAAACAAGTACACCAATCGCGTGGTTACGCTCTGGTATCGGCCCCCTGAGCTACTCCTAGGAGAGCGTGATTATGGTCCTCCCATTGATTTGTGGGGAGCAGGGTGCATCATGGCTGAGATGTGGACCAGAAGCCCCATTATGCAGGGGAATACGGAGCAGCATCAGCTAACACTCATCAGCCAATTATGCGGTTCCATCACACCAGAGGTCTGGCCAAATGTGGACAAATATGAGTTGTACCAGAAGCTGGAACTGCCCAAAGGCCAGAAAAGAAAGGTGAAGGAAAGGTTAAAGGCTTATGTGAAAGATCTCTATGCACTGGACCTTATAGACAAGCTGTTGGTTTTGGACCCGGCTCAGAGAATCGACAGTGATGACGCCCTGAATCATGATTTCTTCTGGTCTGACCCGATGCCTTCTGATCTGAAGAACATGCTCTCTACTCACAATCAGTCCATGTTTGAATACTTGGCACCTCCTAGGAGAAGAGGCGGGCACATGCCCCAACAGCCAGCCAATCAGGCACGGAATCCTGCTGCCACAAACCAATCAGAATTTGACAGAGTCTTTTAA
Full Trace Sequence: ggcgattccatgtgaataggcggagggttggaatacacaagcgcggcgaattctattgggccactgcggggttgtgactgaaagaaatgccgaggctgtaaggcctaagaccgtccttaaactgctactgacgccttcagtgttttcacacacgtctcccagtaggagtccgaggctttgcggcctagcccaagtcaacccgtcagacagcctgaactcgtcggctcagcaccgggaaaggccggggcccggcggcctgtgcccggaatctgattctcgagggccttccggctcggaaccccctccctccgccatggccaagaactacgactcggtggaattcccttactgtgatgaggtctccaagtacgagcggctcgccaagatcggccagggcaccttcggggaagtgttcaaggccaaacatcgacagacggggaagaaagtggcacttaaaaaagttctgatggaaaacgagaaggaagggttccctatcacggctctgcgagagataaaaatcctgcagctgctgaaacacgagaacgtagttaacctcatagagatctgtcggacaaaaatttctcccacagccaaccagtacaatagatgcaaaggaactattttcctggtgttcgacttttgtgagcatgatctagcaggcttgctgagcaatgctcatgtcaagttcacgctctccgagatcaagaaggtaatgcaaatgctgctcaacggcctctactacattcaccggaacaagatcctgcacagagacatgaaggcagcaaacgtactgatcaccagggacggagtgttgaaacttgcagactttgggcttgccagagcattcagccttgccaagaacagccagccaaacaagtacaccaatcgcgtggttacgctctggtatcggccccctgagctactcctaggagagcgtgattatggtcctcccattgatttgtggggagcagggtgcatcatggctgagatgtggaccagaagccccattatgcaggggaatacggagcagcatcagctaacactcatcagccaattatgcggttccatcacaccagaggtctggccaaatgtggacaaatatgagttgtaccagaagctggaactgcccaaaggccagaaaagaaaggtgaaggaaaggttaaaggcttatgtgaaagatctctatgcactggaccttatagacaagctgttggttttggacccggctcagagaatcgacagtgatgacgccctgaatcatgatttcttctggtctgacccgatgccttctgatctgaagaacatgctctctactcacaatcagtccatgtttgaatacttggcacctcctaggagaagaggcgggcacatgccccaacagccagccaatcaggcacggaatcctgctgccacaaaccaatcagaatttgacagagtcttttaaagacattctttattatttattgggaggaaaaaaaagactttttttaaaaatatatatatattttttttaattcctttgtaagtaagcctgtatagtatggggaataaggactagctgcatacttttgttagcataatgatattcagaagcgtggcattcgtgaaacaaaacttttaactgtgatacttaatctaaaactcttgctaccatgctgatacacactggtcagtgaatcgaaagttttccgaacagctttctgtgctgctgtacctatgtacttgatagggaatgtaaataaagttttatgttctcctataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAKNYDSVEFPYCDEVSKYERLAKIGQGTFGEVFKAKHRQTGKKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKISPTANQYNRCKGTIFLVFDFCEHDLAGLLSNAHVKFTLSEIKKVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNKYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLTLISQLCGSITPEVWPNVDKYELYQKLELPKGQKRKVKERLKAYVKDLYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKNMLSTHNQSMFEYLAPPRRRGGHMPQQPANQARNPAATNQSEFDRVF
Donor tissue: gastrula