ORFeome > cdkal1 – XORFeome 2.0

cdkal1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis CDK5 regulatory subunit associated protein 1-like 1, mRNA (cDNA clone MGC:76088 IMAGE:5308174), complete cds
Gene Symbol: cdkal1
Gene ID: 394802
ORF gb_acc: MG132753
ORF ID: 10056

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063205

Library Location

Plate ID: GDExt11001
Well Location: H11

EST Sequences

Clone: MGC:76088 IMAGE:5308174
Trimmed Sequence: ATGCCTGCTGCCTGTGAGTCTTTGCTGGATGACATTGAAGACATTGTCTCAGCTACAGACCCAAAGCCTCATGATCGCCAAAATGCAAGACAAAACATAGTACCCAGAGCACGGAAAAGAAATAAAAACAAAATTCAAGAGGAAGAACCCCCTGCTGATAGCACAATACCTGGCACTCAGAAGATCTGGATCCGTACATGGGGCTGCTCACATAACAACTCCGATGGTGAATATATGGCGGGACAACTGGCTGCATATGGCTACAGCATAACTGAGCAGCCTGAGCAAGCAGATTTGTGGCTACTGAACAGTTGCACTGTGAAGAGTCCAGCTGAGGACCACTTCAGGAACTCCATTAAGAAAGCTCAAGAAGCAAACAAAAAAGTTGTACTGTCTGGATGTGTACCTCAAGCGCAACCACGTCAAGAGTACATGAAAGGACTGAGTATCATAGGGGTGCAGCAAATAGATCGTGTGGTTGAAGTTGTAGAAGAAACAATTAAAGGTCACTCTGTGAGACTGCTGGGTCAGAAAAAGGATAATGGAAAACGGTTGGGGGGAGCTCGATTGGATTTGCCAAAGATTAGGAAGAACCCACTGATAGAAATCATTTCCATCAATACAGGGTGTTTGAATGCTTGCACATACTGTAAAACAAAGCACGCAAGAGGAGAACTTGCTAGTTACCCAGTGGAAGAATTGGTTGACAGAGCTGCACAGTCTTTCCAAGAGGGTGTCTGTGAGATCTGGCTGACCAGCGAAGACACTGGAGCTTATGGCAGAGACATTGGGACAGATCTCCCAACGCTCTTATGGAAGCTGGTTGAAGTTATCCCTGAGGGCGCTATGCTGCGGCTAGGCATGACCAACCCCCCTTATATATTAGAGCACCTGGAGGAGATGGCAAAGATCCTGAATCATCCAAGAGTGTATGCGTTCCTGCACATCCCTGTACAATCTGCCTCAGACAGTGTGCTCATGGACATGAAGAGAGAATACTGTATTGCAGACTTCAAAAGAGTGGTGGATTTTCTTAAAGAGAGAGTGCCCGGAATAACAATCGCTACGGACATCATTTGTGGCTTTCCAGGAGAGACAGATGAGGATTTTAAGGAGACATTAAAATTGGTTGAGGAGTACAAATTCCCCAGTCTCTTCATTAATCAGTTTTACCCACGCCCTGGGACCCCAGCTGCTAAAATGGAGCAAGTTCCAGCTCATGTGAAAAAGCAAAGGACCAAGGAGCTGTCCCAACTCTTCCATTCATATAGTCCCTATGATCACAAGATTGGGGAGGAGCAACACGTTTTGGTAACAGAAGAGTCCTTTGATTCCCAGTATTATGTGTCTCATAATCGTTTCTACGAACAGGTTCTTGTCCCTAAGGATCCTGCATTTGTGGGAAAAATGGTTGAAGTGAAAATTTTTGAAGCAGGGAAACATTTTATGAAGGGGCAACCAGTTCAAGATTCTTACATTTATACTCCATCCATTACTAAGCCTCTAGCAAAAGGAGAAGTTTCTGGATTAACGGAGGAGTCAAAGCCACCAAACAACCCCGAATCCCTTCTGCAGACGTCCCGGGAAGGACTACAAACCTTCTTTTTTGTCACTGCTCTGCTGGCTGCTGTCATTGCTTTTGTTGGAATAAAATTGCTTTAA
Full Trace Sequence: cacacttctccggagtcggccaggaaatgcctgctgcctgtgagtctttgctggatgacattgaagacattgtctcagctacagacccaaagcctcatgatcgccaaaatgcaagacaaaacatagtacccagagcacggaaaagaaataaaaacaaaattcaagaggaagaaccccctgctgatagcacaatacctggcactcagaagatctggatccgtacatggggctgctcacataacaactccgatggtgaatatatggcgggacaactggctgcatatggctacagcataactgagcagcctgagcaagcagatttgtggctactgaacagttgcactgtgaagagtccagctgaggaccacttcaggaactccattaagaaagctcaagaagcaaacaaaaaagttgtactgtctggatgtgtacctcaagcgcaaccacgtcaagagtacatgaaaggactgagtatcataggggtgcagcaaatagatcgtgtggttgaagttgtagaagaaacaattaaaggtcactctgtgagactgctgggtcagaaaaaggataatggaaaacggttggggggagctcgattggatttgccaaagattaggaagaacccactgatagaaatcatttccatcaatacagggtgtttgaatgcttgcacatactgtaaaacaaagcacgcaagaggagaacttgctagttacccagtggaagaattggttgacagagctgcacagtctttccaagagggtgtctgtgagatctggctgaccagcgaagacactggagcttatggcagagacattgggacagatctcccaacgctcttatggaagctggttgaagttatccctgagggcgctatgctgcggctaggcatgaccaaccccccttatatattagagcacctggaggagatggcaaagatcctgaatcatccaagagtgtatgcgttcctgcacatccctgtacaatctgcctcagacagtgtgctcatggacatgaagagagaatactgtattgcagacttcaaaagagtggtggattttcttaaagagagagtgcccggaataacaatcgctacggacatcatttgtggctttccaggagagacagatgaggattttaaggagacattaaaattggttgaggagtacaaattccccagtctcttcattaatcagttttacccacgccctgggaccccagctgctaaaatggagcaagttccagctcatgtgaaaaagcaaaggaccaaggagctgtcccaactcttccattcatatagtccctatgatcacaagattggggaggagcaacacgttttggtaacagaagagtcctttgattcccagtattatgtgtctcataatcgtttctacgaacaggttcttgtccctaaggatcctgcatttgtgggaaaaatggttgaagtgaaaatttttgaagcagggaaacattttatgaaggggcaaccagttcaagattcttacatttatactccatccattactaagcctctagcaaaaggagaagtttctggattaacggaggagtcaaagccaccaaacaaccccgaatcccttctgcagacgtcccgggaaggactacaaaccttcttttttgtcactgctctgctggctgctgtcattgcttttgttggaataaaattgctttaaaaacaattgtttagggaagctggaaaaattctagcattttagcccactttttagtcatttcaatttgattagtgtgaaacttctgcccattattacttaccaccatttaattggcttttaagtctcttgggaatatacccagatgttaaagatgtgtttttttttaatccttcagttgatagtccctctgtaagagtaagtaacctgcaatgctgctgcgttgctcgattctccacttctttttcatattgtgatcttcagccttagttctgtacatgtgatacttgtaaatacaagcgtcagtgccagatgctgtgacctggcttcatcctgatgaaggaaacacagggggaaaggtcacgtttattaatagcatgccgccaaataaaatgtaaaaagtatttttttttccttttgttactatccatgtgagcagtcatactgataaattctttccagccaagtgagaaaagaagggatatgtttccaatcaaaaagcagaaaagtcaaatactgattaatttcttctcatctaaatgtggcatctccagtttgtgcatgagtcgctcctcactgtgtctgactgctccatatacaggtcaatttgattggataattgtgcaccatttcactttaggtaagcagtgatgtgcactcttgtttcctgtagataattaaagtctgccgaccgcaaccggtgatgtgcgtgtgtgtgttttgaaaatgcattaagttattttgaaacattgttcacattttttttttgccttactgggatatttgcttttattgagatgagaacaagatgcattattaaacattatttacactgagaaaaaaaattaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPAACESLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQKIWIRTWGCSHNNSDGEYMAGQLAAYGYSITEQPEQADLWLLNSCTVKSPAEDHFRNSIKKAQEANKKVVLSGCVPQAQPRQEYMKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGKRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGELASYPVEELVDRAAQSFQEGVCEIWLTSEDTGAYGRDIGTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMDMKREYCIADFKRVVDFLKERVPGITIATDIICGFPGETDEDFKETLKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAHVKKQRTKELSQLFHSYSPYDHKIGEEQHVLVTEESFDSQYYVSHNRFYEQVLVPKDPAFVGKMVEVKIFEAGKHFMKGQPVQDSYIYTPSITKPLAKGEVSGLTEESKPPNNPESLLQTSREGLQTFFFVTALLAAVIAFVGIKLL
Donor tissue: gastrula