ORFeome > centa2 – XORFeome 2.0

centa2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Centaurin-alpha2 protein, mRNA (cDNA clone MGC:76109 IMAGE:5308657), complete cds
Gene Symbol: centa2
Gene ID: 394901
ORF gb_acc: MG132708
ORF ID: 10000

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064211

Library Location

Plate ID: GDExt11001
Well Location: H03

EST Sequences

Clone: MGC:76109 IMAGE:5308657
Trimmed Sequence: ATGTCTGGAGAACATAACTGGAATGCAGCAACTGTCAAGAATTTAACTGCAAGAGAAGGAAATGGAACCTGTGCAGACTGCAGAGCTCCAGATCCTCAGTGGGCTTCCCCCACACTGGGCATCTTCCTTTGCGTGGATTGCTCAGGGATCCACCGCAATCTGCCAGAAATCAGTAAAGTGAAGTCTTTGATTATGGACAACTGGGATGACACCCAAGTTCAGTTCCTAGCCAGCCACGGGAATATTGCAGCCAAAGCAATATATGAGGCTCATGTGCCTGTGTATTACTACAGACCAAAGCATACGGATTGCCATGTTTTAAGAGAGCAGTGGATTCGATCAAAGTATGAGCGCAAAGAATTCATTAAACCCAAAGGAAACATTTCTAATGGCTCAAAAGAGGGGAACCTTCTCAAGCGAGGGCGGGATAATGGACAGTACCTGCCGAGAAAATTTTTCCTGTCCGAGATAGATGGCACCCTAAAATACTTCACAAAGCCTGACGCCAAGGAACCAAAGACAGTGATCAGAATTGACACTGTTAATGCCAGCTTCCAGCCCGTGAAGATGAAAAATGCCAATGGCTTACAGATCACATATGTCAAGGACAACAAGACGAGAAATATATTCGTGTATCACAATGACGGACAGGAGATTGTAAGCTGGTTTAATGCCATCCGATCAGCCCAGTTCAGCTACATGCAAATTGCCTTTCCAAAAGCATCAGACAAAGAGATCATCAGTCGCCTGACCCGAAATTTTTTGAAAGAAGGTTACATGGAAAAGACTGGACCCAAGCAAACTGATGGCTTTAAGAAAAGATGGTTCACTCTTGACCATCGAAGACTGATGTATTTCAAGGACCCTTTGGATGCTTTTGCCAAAGGGGAGTTGTTTTTAGGAAGCAGTCAGAATGGTTATGAGGTGAAGCCTGTGATAGTCCCCTCCACACATGGTAACTGCACCTGGAATTATGGCATCTCAATCACTACCCCAGAACGCACCTACCTTTTTACCTGCGAGAGTGAAAGTGAGCGGGAGAACTGGCTCCTTGTGTTCAAGGAGGTGATCAGCCAACCCATGACTGTTAGGGAATTCTCAGTTGAAGCACAGTTTAAGACAAGGTCCTAA
Full Trace Sequence: atcccctgctgtgcctgtgcatgtaacatactgcagcaacactgatacacacttgtggctctgcgtggggacgccctgggtgtttctgcaggtagagaacactggcctaacaccccgagtaagcatgtctggagaacataactggaatgcagcaactgtcaagaatttaactgcaagagaaggaaatggaacctgtgcagactgcagagctccagatcctcagtgggcttcccccacactgggcatcttcctttgcgtggattgctcagggatccaccgcaatctgccagaaatcagtaaagtgaagtctttgattatggacaactgggatgacacccaagttcagttcctagccagccacgggaatattgcagccaaagcaatatatgaggctcatgtgcctgtgtattactacagaccaaagcatacggattgccatgttttaagagagcagtggattcgatcaaagtatgagcgcaaagaattcattaaacccaaaggaaacatttctaatggctcaaaagaggggaaccttctcaagcgagggcgggataatggacagtacctgccgagaaaatttttcctgtccgagatagatggcaccctaaaatacttcacaaagcctgacgccaaggaaccaaagacagtgatcagaattgacactgttaatgccagcttccagcccgtgaagatgaaaaatgccaatggcttacagatcacatatgtcaaggacaacaagacgagaaatatattcgtgtatcacaatgacggacaggagattgtaagctggtttaatgccatccgatcagcccagttcagctacatgcaaattgcctttccaaaagcatcagacaaagagatcatcagtcgcctgacccgaaattttttgaaagaaggttacatggaaaagactggacccaagcaaactgatggctttaagaaaagatggttcactcttgaccatcgaagactgatgtatttcaaggaccctttggatgcttttgccaaaggggagttgtttttaggaagcagtcagaatggttatgaggtgaagcctgtgatagtcccctccacacatggtaactgcacctggaattatggcatctcaatcactaccccagaacgcacctacctttttacctgcgagagtgaaagtgagcgggagaactggctccttgtgttcaaggaggtgatcagccaacccatgactgttagggaattctcagttgaagcacagtttaagacaaggtcctaacacgatgcctcttctgtacgacatgatcatattcactcttctaagactttaaatttgtggtgcccatttcatacacatcctgtcactttatttcattgctggagcactgcatgaggccttttaggagtaagaagatttcacataaataaactttacagcaataacaacaagaaaaaatataatgtatgtgcattgtttaaatatgggcaatcaaaatcctcagtatgttatagtatgtcttaaaatgcccttcatggttgaggaccctcaaacacagcaggattcattaattgttggactggggtgtgtggggctcaccgctcagttgcccccaccccagttacaagctgctctgcactgcaaacccagtctccactctttcccctgctgcgcacatgcacctgcggcccgtaccttgtgttcccttacagccactgccaggaatgcccacagttcctggtaaggagcaggcctggggcaacagggctcatgtttttcccagtgtccatctggtccagtctgacccagggctcatttacacatgctgggcaatttggacctgagcagtaacatggaaaccaaacaaattttctatttctatttgcaacttgccataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSGEHNWNAATVKNLTAREGNGTCADCRAPDPQWASPTLGIFLCVDCSGIHRNLPEISKVKSLIMDNWDDTQVQFLASHGNIAAKAIYEAHVPVYYYRPKHTDCHVLREQWIRSKYERKEFIKPKGNISNGSKEGNLLKRGRDNGQYLPRKFFLSEIDGTLKYFTKPDAKEPKTVIRIDTVNASFQPVKMKNANGLQITYVKDNKTRNIFVYHNDGQEIVSWFNAIRSAQFSYMQIAFPKASDKEIISRLTRNFLKEGYMEKTGPKQTDGFKKRWFTLDHRRLMYFKDPLDAFAKGELFLGSSQNGYEVKPVIVPSTHGNCTWNYGISITTPERTYLFTCESESERENWLLVFKEVISQPMTVREFSVEAQFKTRS
Donor tissue: gastrula