ORFeome > chchd4 – XORFeome 2.0

chchd4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis coiled-coil-helix-coiled-coil-helix domain containing 4, mRNA (cDNA clone MGC:76323 IMAGE:5380370), complete cds
Gene Symbol: chchd4
Gene ID: 394473
ORF gb_acc: MG132888
ORF ID: 10252

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059772

Library Location

Plate ID: GDExt11002
Well Location: D10

EST Sequences

Clone: MGC:76323 IMAGE:5380370
Trimmed Sequence: ATGTCCTACTGCAGGCAGGAAGGAAAGGACAAAATCATTTTTGTAACCAAGGAGGACCATGAAACTCCCAGTAGCGCCGAGCTGATCGCAGATGATCCAAATGACCCTTATGAGGACCATGGGCTCATCTTGCCAAATGGAGACATCAACTGGAACTGCCCGTGCCTTGGAGGCATGGCCAGCGGGCCTTGTGGGGAGCAGTTTAAGTCGGCTTTCTCTTGCTTTCACTACAGTCAGGAGGAGATAAAGGGCTCTGACTGCCTGGATCAGTTTCGGGCGATGCAGGAATGCATGCAGAAATACCCCGACATCTATCCACAGGAGGATGATGAGGACGAGGCAGAAAAAGAGAAGCAGAATAAAGAAGCTGAAGCTTTTAGTACAGAAACTTCTGATACCAAAGAAGAGAGTTCCAGCTAA
Full Trace Sequence: cgtgattggtgtgcgcaggcggtgctgtgccgggcgccgtgttgtggagctgcagccatgtcctactgcaggcaggaaggaaaggacaaaatcatttttgtaaccaaggaggaccatgaaactcccagtagcgccgagctgatcgcagatgatccaaatgacccttatgaggaccatgggctcatcttgccaaatggagacatcaactggaactgcccgtgccttggaggcatggccagcgggccttgtggggagcagtttaagtcggctttctcttgctttcactacagtcaggaggagataaagggctctgactgcctggatcagtttcgggcgatgcaggaatgcatgcagaaataccccgacatctatccacaggaggatgatgaggacgaggcagaaaaagagaagcagaataaagaagctgaagcttttagtacagaaacttctgataccaaagaagagagttccagctaatagaggacaggaggcaaatgggcctccctttatctcccaccttctgttgctccatggaccataatatgcaaagaggtgtcttaacaccgtagcaagatctaatcacaatataatctgtctttgtgagggacctatagcagcatgaaatccagctctacacccaatctcagcccaattagcaagagatgtgacatcactgtggcctgactgtcctatgatactttgaaatcatgtatttatagaagccgtctctggataagcagcaacaagtccaattcacttgccctttttgtcacagttttctaatttaacttttttatttctgttactataaaaagggaacaaccataaaaaacctgtaattaagattagaagcaaccctgttattgtacaaagtttccagtctgtgcctgattattctctttaggttgaatgatagcggctatgcatggtaaccactatgtgagatatgattggttccctgatccagccagtcagaagaaggcaagtctgagagagttccttaccttctgttgtgcctcagcccttgtggtgccacctcatacttgtgacacgtgcactgaccttgtgagattgcccttctctgggatgtgggtgatcagagaatatattaaagacctttttaccttatgacttaaaaaaaaaaaaaaaaaaa
Translation: MSYCRQEGKDKIIFVTKEDHETPSSAELIADDPNDPYEDHGLILPNGDINWNCPCLGGMASGPCGEQFKSAFSCFHYSQEEIKGSDCLDQFRAMQECMQKYPDIYPQEDDEDEAEKEKQNKEAEAFSTETSDTKEESSS
Donor tissue: tadpole