ORFeome > churc1 – XORFeome 2.0

churc1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis churchill domain containing 1, mRNA (cDNA clone MGC:79649 IMAGE:6980207), complete cds
Gene Symbol: churc1
Gene ID: 493426
ORF gb_acc: MG133744
ORF ID: 11312

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080951

Library Location

Plate ID: GDExt11012
Well Location: B11

EST Sequences

Clone: MGC:79649 IMAGE:6980207
Trimmed Sequence: ATGTGCGGAGGCTGTGTGCAGGAGGAGTACCCGGATCGGGGCAGCACATGCTTGGAGACAGGTTCATTCTTGTTAAACTATGTGAGTTGCGTTCAGTGCAATAAGAGAGACTTTGTTCTCATAGTGAATAAAACAGCAGAGGAAGAGGATGGTGAAGAGATTATCACTTATGATCATATGTGCAAAAACTGTCACCATGTGATTGCAAAACATGAATACACCTTTAGTGTGGTTGATGACTATCAGGAATATACCATGCTGTGCATGCTGTGCGGAAGAGCTGAGGACTCTGTCAGCGTTCTGCCTGATGACCCACGACAGATGGCTCCACTTTTTTAA
Full Trace Sequence: gaaagcgcagcgcacagaacggtgcttctactttttcctgcgagcggggatttgttctgactccccagctaagacagcgacatgtgcggaggctgtgtgcaggaggagtacccggatcggggcagcacatgcttggagacaggttcattcttgttaaactatgtgagttgcgttcagtgcaataagagagactttgttctcatagtgaataaaacagcagaggaagaggatggtgaagagattatcacttatgatcatatgtgcaaaaactgtcaccatgtgattgcaaaacatgaatacacctttagtgtggttgatgactatcaggaatataccatgctgtgcatgctgtgcggaagagctgaggactctgtcagcgttctgcctgatgacccacgacagatggctccacttttttaaacctatgacattgattgctgtcagaactgcaaacaaaatagaatattatttctgcaatcatttcacataaaactatgactactcaaactgttgtagtgttaaacctctgcacagtattataacacaaatgctagcttttatggattttgttttagaatgcataaacattaatagtgttctagacaaagtagaagtacatttgtcacatgcttatgtttcttgatattgctctaaatatatacatacaaaattagcaaattgcaaaataggtaacttcaaacagttaaactacactattgctcagtctttttcaataatttcctcctaacttacttcaagctgcagtgcccataaggctaatgccagacggggctgatcctcagcatgcctctatgcttctttcattgcaactgctgaaatccactccatgtgccttcacccgggccgacacaatagctccaggtgcaggcacgaggaatagatgatgccaaagtaggggctgattttcagcctgggtttatctgcagtagcctaaactatgattatttgtcttcatgttttataagtgaaattcttatattcattattcttttttctggtttactgtacatgtataggatctattatctagaatgtttgggacctgttttttttttcctaatttggatctccataccttaaggctactgaaaaaaaatatttaaagattagaatcaccccagtgggagtatgttgccaccaatatctaattattctagcaattaccataaagtacaagttactgttttatgcttacagggaaaaattagacttatttaattaaaataaactctatgggagattgtcgtcttataattcccatacctgtaactacctaaaaaatacaaactggcctttagccagaattctgaaatatctgatcataaaaaaaaacaacaaatttctaattggtaagcctgtttgatgttgtgctagaaattaaaagaatttcatttctggacatgtccccctcatatattagctaaactttcttctcgttgtcttgtttcaaaatgttcatattctttaaggatatctcttaataaattgcacagagaacactttgtataaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MCGGCVQEEYPDRGSTCLETGSFLLNYVSCVQCNKRDFVLIVNKTAEEEDGEEIITYDHMCKNCHHVIAKHEYTFSVVDDYQEYTMLCMLCGRAEDSVSVLPDDPRQMAPLF
Donor tissue: tailbud