ORFeome > cldn3 – XORFeome 2.0

cldn3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis claudin 3, mRNA (cDNA clone MGC:88932 IMAGE:7000173), complete cds
Gene Symbol: cldn3
Gene ID: 448229
ORF gb_acc: MG134058
ORF ID: 11677

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075291

Library Location

Plate ID: GDExt11016
Well Location: A03

EST Sequences

Clone: MGC:88932 IMAGE:7000173
Trimmed Sequence: ATGTCTATGGGACTAGAGATTCTAGGTGTGGCGCTTTCTATCGTTGGCTGGCTAGGAACTGTGATTAGCTGCGCTCTACCTATGTGGAGGGTAACCGCATTCATTGGTAACAACATTGTGGTGGCCCAGACCATTTGGGAAGGACTATGGATGAACTGTGTGGTGCAGAGCACAGGGCAAATGCAGTGCAAAATGTACGACTCCCTCTTAGCTCTTCCTCAAGACCTCCAAGCAGCTCGCGCCCTGATGGTGATCTCCATTGTCATTGCTGTGCTGGGAGTTCTCATATCCATCATTGGTGCCAAGTGCACTAATTGTGTCCAGGATGAGTCAGCCAAGGCCAAAATTATGATCGTTTCTGGAGTTATCTTTATCCTTTCTGGCCTTATGACACTTATCCCTGTGTCCTGGTCTGCAAACACTATTATCCGTGATTTCTACAATCCTTTGGTAGTGGATGCACAAAAGAGAGAGCTTGGCTCCTCAATGTACATTGGATGGGCAGCCTCTGCTCTTCTTATGCTTGGGGGAGCAATGCTCTGCTGTTCTTGCCCCCCAAAAGAGAAGTACCCTACTTCAAGGGTGGCTTATTCAGCTGCCAGGTCAACAAATCCTGGTTATGACAGAAAAGACTATGTCTGA
Full Trace Sequence: cgcctatttacctgaaggacattctctactgggcagcctgggcactcatccaagcagagcagccaaccagatacagggttgaacaagtcagtgcaccagtacaggcaacctcacagacacagaggaaacagaaccacaagaaactctgaagctggagacaagagtcataggcagtatatttcaacagagacttcactacaaagggtaccttaacagagacatcaggctcaacagactgccaaagatcaattaaagtggtttctgaaggaaatagttcatctagcagctgtttctctaagaatcatcatctggtcatcttcaacaccgtcctgacatctcttacctgtcaacatgtctatgggactagagattctaggtgtggcgctttctatcgttggctggctaggaactgtgattagctgcgctctacctatgtggagggtaaccgcattcattggtaacaacattgtggtggcccagaccatttgggaaggactatggatgaactgtgtggtgcagagcacagggcaaatgcagtgcaaaatgtacgactccctcttagctcttcctcaagacctccaagcagctcgcgccctgatggtgatctccattgtcattgctgtgctgggagttctcatatccatcattggtgccaagtgcactaattgtgtccaggatgagtcagccaaggccaaaattatgatcgtttctggagttatctttatcctttctggccttatgacacttatccctgtgtcctggtctgcaaacactattatccgtgatttctacaatcctttggtagtggatgcacaaaagagagagcttggctcctcaatgtacattggatgggcagcctctgctcttcttatgcttgggggagcaatgctctgctgttcttgccccccaaaagagaagtaccctacttcaagggtggcttattcagctgccaggtcaacaaatcctggttatgacagaaaagactatgtctgaaatggacattctgggtccttatgaaggactgaagggactgtcttgtattggacttgtgacaagcaaaagggagcaaaaggaagaagttaccccctccataaactaacatttacaattattcctctaggtactgcatttgttgatatttgttatatatatgctatatattattttagatgtattgccccttttgactgcacagtgtgcatttgttgtgttagtgtttgaatgtgcactgtaaagatattaatgttttccattgccgtggcatttgtagaatattcttgaacagggaggggcattcggtggcagagatgaggtggctgtactgcattaaccgtttccataaatgcagcttactttcttttgtctaaatacaaagcattacactgctctatccattgatatttcattatccatggaaacctcccattagatactgatgcaataccattcccaaattaggcaatattattgattactgcaagatgatatatttaattattctcatggatgaattttgcatttggacctgttttgttgctagtagaatctgatggtctatactttgtttccaacaatagagataatgcatcagttttacagtaaaccaactgtctgccttctgtttcatgtctgtttgttctttgttttgctcctcctcctgtcccctttcttactgtaggttacatgtcaggttggaatttgacccatttcctctctattggctcctagttttccctgcagattgtatagtaaggcagtgttaccttctcattatctcagatttgaaacacaacccatcccttgtctagctttgtgtaaatattcctgcagagtggggtcaaactacctgttttttaggagttactttaagcttgagcgtggcatattaacagtattcttgttaatggataacagcccagatatagcacttctcactagcagtacctatggtgttagatatggcactggaatgttaactctgccccttatacgcaagaatacacttcatcaaaaataagttctaaaccttactatctacaattatttttaatgtttattttaattaccatgtccctggatataatttcagtatctcagtcaatgaggtctttctaatgagcatcaagcagtaaaaaactctaattaaacagtcacttatttcacacaagtgggtcactcacaagacctgttcttagtcccatggcctctaactaggctgtcctagctaaggaacatgaaacagatggagtgttgcaagctacctacgccagagatacaattttattttaacttcttttgtattttatcaatggaggcacattcactgtacagaaatatgcatataaatatatagataggcagttaaatgtttatatatactctacacacacatgtataaatgtataggtccacacctttttgttatcccagtgaaattctgtttcatattttaacttcaacaactaatcaacacatcacaaaagcattttgcagtttggatgaaaatttcaacagcattttttactctgcaccaaaatttgtgtgatttgtattccttccattgctaccactgttttatattaaccttttgtttttctttaatattgtgtatcagttagtaagcaggtagatatgaaatgtacatgttttctgtcccatcatctaggagcacattgtatttacgccagtgatggtgcattgcattgtacattgtacatcaagtttatcattattatgtatatattaaaacaccttttgactgaaaatatattaaacacttcctataaatcaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSMGLEILGVALSIVGWLGTVISCALPMWRVTAFIGNNIVVAQTIWEGLWMNCVVQSTGQMQCKMYDSLLALPQDLQAARALMVISIVIAVLGVLISIIGAKCTNCVQDESAKAKIMIVSGVIFILSGLMTLIPVSWSANTIIRDFYNPLVVDAQKRELGSSMYIGWAASALLMLGGAMLCCSCPPKEKYPTSRVAYSAARSTNPGYDRKDYV
Donor tissue: