ORFeome > clic1 – XORFeome 2.0

clic1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chloride intracellular channel 1, mRNA (cDNA clone MGC:75951 IMAGE:5384001), complete cds
Gene Symbol: clic1
Gene ID: 394484
ORF gb_acc: MG133477
ORF ID: 11000

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059765

Library Location

Plate ID: GDExt11009
Well Location: D12

EST Sequences

Clone: MGC:75951 IMAGE:5384001
Trimmed Sequence: ATGTCAGAACAACCTCAGGTGGAATTATTTTTGAAGGCTGCGAATGATGGGCAGAGCATCGGAAACTGTCCCTTTTCTCAGCGCCTCTTCATGGTCCTCTGGTTAAAAGGAGTCACGTTTAATGTAACTACAGTTGATATGAAAAAAAAGCCAGATATATTGAAGGATCTGGCACCTGGGGCACAGCCCCCTTTCTTGCTGTTTGCTGGTGAAGTCAGAACAGACACCAATAAGATAGAAGAATTTCTTGAGGAGACATTGTGCCCACCCAAATATCCTAAACTCGCGTGCCGAAACCAAGAATCAAACACAGCTGGACTTGACGTTTTTGCAAGATTTTCTGCCTACATCAAGAATTCCAATCCAGCACCTAACCAGAGTGTGGAAAAAGGTCTTTTGAAGGCATTGAAGGTACTTGATATCTACCTTAACACTCCCCAAATAGATGAAATTGATGAGAACAGTGCAGAAGATGAGCCTGTCTCAAACCGCAAGTTCCTAGATGGTAATGAGCTGACACTGGCTGACTGCAACCTCCTCCCTAAGCTCAACATAGTGCAGGTGGTATGTGAACACTTTCGGGGTTTCAAGATTCCAGCAGAATTTACTGGAATCCATCGCTATCTGCAGAATGCTTATAAACGGGAAGAATTTGCCAGCACTTGTCCTGATGCTGCTGAAATTGTACGTGCATATGCCGAGGTGGCTAAACCTCTAAAATAA
Full Trace Sequence: taattagtgtacgcctactgaagaactactgactttattattatttaagaaatgtcagaacaacctcaggtggaattatttttgaaggctgcgaatgatgggcagagcatcggaaactgtcccttttctcagcgcctcttcatggtcctctggttaaaaggagtcacgtttaatgtaactacagttgatatgaaaaaaaagccagatatattgaaggatctggcacctggggcacagccccctttcttgctgtttgctggtgaagtcagaacagacaccaataagatagaagaatttcttgaggagacattgtgcccacccaaatatcctaaactcgcgtgccgaaaccaagaatcaaacacagctggacttgacgtttttgcaagattttctgcctacatcaagaattccaatccagcacctaaccagagtgtggaaaaaggtcttttgaaggcattgaaggtacttgatatctaccttaacactccccaaatagatgaaattgatgagaacagtgcagaagatgagcctgtctcaaaccgcaagttcctagatggtaatgagctgacactggctgactgcaacctcctccctaagctcaacatagtgcaggtggtatgtgaacactttcggggtttcaagattccagcagaatttactggaatccatcgctatctgcagaatgcttataaacgggaagaatttgccagcacttgtcctgatgctgctgaaattgtacgtgcatatgccgaggtggctaaacctctaaaataaaaagaaaatagaggtctcgtatttaataacattgtaaaaatgccttgcttctatttctaaaagaaggcagaccaccataccaggccagcttgctgtttggcatggtcctattctaccacttttatattcttctctatatagggaatgctatttcattgcccagggtctatgacagacagcagtcattttgatggcgacatctatctcagagttgtttttacttgctgaggttgttgtcatttattgtcattactgacatattattcacctacaattagaaaatcaatgtcagctttatttaaattatagatcacattttacccacggaatagatcagcagaacatcacctccacaccttcctctacttgcttaacctagactgcagttatattttttgtatttagtagtgtggggcaaagatttaaataccacattgtctttttcactgcgtaatcttgtatatttaatttactgagtactacatgctgagtattcatgtttatattaaaaggaattttctccaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEQPQVELFLKAANDGQSIGNCPFSQRLFMVLWLKGVTFNVTTVDMKKKPDILKDLAPGAQPPFLLFAGEVRTDTNKIEEFLEETLCPPKYPKLACRNQESNTAGLDVFARFSAYIKNSNPAPNQSVEKGLLKALKVLDIYLNTPQIDEIDENSAEDEPVSNRKFLDGNELTLADCNLLPKLNIVQVVCEHFRGFKIPAEFTGIHRYLQNAYKREEFASTCPDAAEIVRAYAEVAKPLK
Donor tissue: neurula