ORFeome > clta – XORFeome 2.0

clta – XORFeome 2.0

General Information

Species: Xenopus tropicalis clathrin, light chain (Lca), mRNA (cDNA clone MGC:75712 IMAGE:5380749), complete cds
Gene Symbol: clta
Gene ID: 394591
ORF gb_acc: MG132969
ORF ID: 10345

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061272

Library Location

Plate ID: GDExt11003
Well Location: F06

EST Sequences

Clone: MGC:75712 IMAGE:5380749
Trimmed Sequence: ATGGCTGAGTTTGACATGTTTGGTTCTGTAGGTAATGGGGTATCAGCTGAGGAGGACCCAGCCGCCGCTTTCCTGGCACAGCAGGAGAGTGAAATTGCCGGCATTGAGAACGACGAAGGTTTTAGCATCCTAGACAGCGGGGAGGTACCAATGTCACTACAAGCAGGGGATGGGGCCACAGATACTGTTATGAATGGGGACTTTTATCAGGAGACAAATGGACCAACAGATGGTTATGCAGCCATTTCACATGCTGACCGCTTACAAGCTGAGCCAGAAAGCATTCGCAAGTGGAGGGAAGAGCAGAGAAGCCGTCTAGAAATGTTAGATGCAAACTCAAAAAAACAAGAGACTGAATGGAAGGACAAAGCTGGCAAGGAACTGGAGGAGTGGTATGCCAGGCAGGATGAACTGCTACAGAAGACTAAAGCAAACAATCGGGCTGCCGAAGAGGCTTTCGTGAGCGATGTTGAAGAGACCAGTCCAGGCACAGAATGGGAACGCGTTGCTCGTCTATGTGACTTTAACCCCAAGTCCAGTAAACAGGCGAAAGACGTTTCTCGTATGCGCTCCGTTTTGATCTCCCTTAAGCAGGCTCCATTGGTCCACTGA
Full Trace Sequence: ttcctgtggtctctcatctgtactcgccggctttagggagttgggggtctcgctgttttccggtgacggcgcgtatttccgggcacagactcgctagctttaaccctcattttccagctcgggactacagtgaccatggctgagtttgacatgtttggttctgtaggtaatggggtatcagctgaggaggacccagccgccgctttcctggcacagcaggagagtgaaattgccggcattgagaacgacgaaggttttagcatcctagacagcggggaggtaccaatgtcactacaagcaggggatggggccacagatactgttatgaatggggacttttatcaggagacaaatggaccaacagatggttatgcagccatttcacatgctgaccgcttacaagctgagccagaaagcattcgcaagtggagggaagagcagagaagccgtctagaaatgttagatgcaaactcaaaaaaacaagagactgaatggaaggacaaagctggcaaggaactggaggagtggtatgccaggcaggatgaactgctacagaagactaaagcaaacaatcgggctgccgaagaggctttcgtgagcgatgttgaagagaccagtccaggcacagaatgggaacgcgttgctcgtctatgtgactttaaccccaagtccagtaaacaggcgaaagacgtttctcgtatgcgctccgttttgatctcccttaagcaggctccattggtccactgaaaataaagcacaaaagcaaaaaattccgtgaccccctcagcattttaatctttactcagagagcctatgtttgcagattttggttatattttccttctgtacggggaccaaaccttcctaacgtgtatgggattgatcattgtttgtaacttgctgtcttccccttctcctcccatgtacctagaaattaaatctgtaagggaacccaccacccttgaggtctttgtgcttctgtgttaacaaaattatttcatatagatttgtgaaaaatcagaatagtgatattaaagttctatcaactgtaaaaaaaaaaaaaaaaaaaaaa
Translation: MAEFDMFGSVGNGVSAEEDPAAAFLAQQESEIAGIENDEGFSILDSGEVPMSLQAGDGATDTVMNGDFYQETNGPTDGYAAISHADRLQAEPESIRKWREEQRSRLEMLDANSKKQETEWKDKAGKELEEWYARQDELLQKTKANNRAAEEAFVSDVEETSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
Donor tissue: tadpole