ORFeome > cmbl – XORFeome 2.0

cmbl – XORFeome 2.0

General Information

Species: Xenopus tropicalis carboxymethylenebutenolidase homolog, mRNA (cDNA clone MGC:76315 IMAGE:5380073), complete cds
Gene Symbol: cmbl
Gene ID: 394496
ORF gb_acc: MG132853
ORF ID: 10207

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061630

Library Location

Plate ID: GDExt11002
Well Location: C12

EST Sequences

Clone: MGC:76315 IMAGE:5380073
Trimmed Sequence: ATGGCAAACGAAGCTTGCCCCTGCCCATGTGATATTGGAGATAAGATTGAATATGGAGCAAAAGGCCAGGAGGTCCAAATTGAGCACATAAAAGCTTATGTTTCTAAACCTCATTCTAGCACAGATAAAGCAGTGATTGTAGTTCAGGATATATTTGGATGGCAACTTCCTAACACTCGCTTTATGGCTGATCTACTCACAGCTCATGGATACATAACAATTTGTCCAGATTTTTTTGTGGGCCAGGAGCCTTGGAAGCCATCAAATGACCGGTCTACATTCACTGAGTGGCTGCAGACTCGACAAGCAACAAAAGTGGAGAAGGAGATTAATGTTGTACTCAAGTATCTGAAGGAGCAGTGTCATGTGAAGAAGATTGGTGTCATTGGCTTTTGCTGGGGTGGAGTTGTGACTCATCATTTGATGCTTAAGTACCCAGAACTAAAAGCAGGGGTGTCCTTCTACGGAATAATCCGAGATGTTGAAGATCGATACAATTTGCTAAATCCAACATTATTCATTTTTGCTGAAATGGACCATGTCATTCCGCTAGAGCAGGTATCTCTACTTGAAGAAAAACTTAAAGTGCATTCCAAGGTAGATTTTCAAGTCAAAGTGTTTCCAAAACAAACCCATGGATTTGTGCACAGAAAGAATGAAGACATTAACCCAGAAGACAAACCTTTTATTGAAGAAGCAAGAAAGAACATGTTAGAATGGCTGCACAAATATATTAACTGA
Full Trace Sequence: gctggatgcaagagagctctcttggttcggctccgtatcgctccacgcggaagtgctaagaacagctttctaatggcaaacgaagcttgcccctgcccatgtgatattggagataagattgaatatggagcaaaaggccaggaggtccaaattgagcacataaaagcttatgtttctaaacctcattctagcacagataaagcagtgattgtagttcaggatatatttggatggcaacttcctaacactcgctttatggctgatctactcacagctcatggatacataacaatttgtccagatttttttgtgggccaggagccttggaagccatcaaatgaccggtctacattcactgagtggctgcagactcgacaagcaacaaaagtggagaaggagattaatgttgtactcaagtatctgaaggagcagtgtcatgtgaagaagattggtgtcattggcttttgctggggtggagttgtgactcatcatttgatgcttaagtacccagaactaaaagcaggggtgtccttctacggaataatccgagatgttgaagatcgatacaatttgctaaatccaacattattcatttttgctgaaatggaccatgtcattccgctagagcaggtatctctacttgaagaaaaacttaaagtgcattccaaggtagattttcaagtcaaagtgtttccaaaacaaacccatggatttgtgcacagaaagaatgaagacattaacccagaagacaaaccttttattgaagaagcaagaaagaacatgttagaatggctgcacaaatatattaactgattctatgtcatttttaatattttcagtttgtttttcagagttgcagtgtactgaaaaccattggttacagggcacatggtaacatagcattaaatgatattactaaaaaaaaaaaaaaa
Translation: MANEACPCPCDIGDKIEYGAKGQEVQIEHIKAYVSKPHSSTDKAVIVVQDIFGWQLPNTRFMADLLTAHGYITICPDFFVGQEPWKPSNDRSTFTEWLQTRQATKVEKEINVVLKYLKEQCHVKKIGVIGFCWGGVVTHHLMLKYPELKAGVSFYGIIRDVEDRYNLLNPTLFIFAEMDHVIPLEQVSLLEEKLKVHSKVDFQVKVFPKQTHGFVHRKNEDINPEDKPFIEEARKNMLEWLHKYIN
Donor tissue: tadpole