ORFeome > cnih4 – XORFeome 2.0

cnih4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cornichon homolog 4 (Drosophila), mRNA (cDNA clone MGC:76215 IMAGE:5336233), complete cds
Gene Symbol: cnih4
Gene ID: 394910
ORF gb_acc: MG132811
ORF ID: 10156

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063923

Library Location

Plate ID: GDExt11002
Well Location: D02

EST Sequences

Clone: MGC:76215 IMAGE:5336233
Trimmed Sequence: ATGGAGGCCGCGCTCTTCATCTTCTCGCTCATTGATTGCTGCGCCCTCATTTTCCTCTCCGTCTACTTCATAATTACTCTGTCGGACTTAGAATGTGACTACATCAACGCTCGTTCCTGCTGCTCCAAACTGAACAAGTGGGTGGTCCCGGAGCTGGTCGGCCATACCGTGGTATCGGTGTTGATGCTCGTGTCGTTACACTGGTTCATCTTCATTCTTAATCTGCCTGTAGCAGCATGGAATATATATAGGTTTATTATGGTGCCAAGTGGAAACTTGGGGGTGTTTGACCCCACAGAGATTCACAATCGGGGGCAACTAAAGTCTCATATGAAAGAAGCCATGATTAAACTTGGATTCCATCTACTCTGTTTCTTCATTTACTTGTACAGTATGATTTTGGCCTTAATAAACGACTGA
Full Trace Sequence: gagagtttgtactgaatgcagtatggaggccgcgctcttcatcttctcgctcattgattgctgcgccctcattttcctctccgtctacttcataattactctgtcggacttagaatgtgactacatcaacgctcgttcctgctgctccaaactgaacaagtgggtggtcccggagctggtcggccataccgtggtatcggtgttgatgctcgtgtcgttacactggttcatcttcattcttaatctgcctgtagcagcatggaatatatataggtttattatggtgccaagtggaaacttgggggtgtttgaccccacagagattcacaatcgggggcaactaaagtctcatatgaaagaagccatgattaaacttggattccatctactctgtttcttcatttacttgtacagtatgattttggccttaataaacgactgagcccaggagcggaattggaagagaagccctatgtccccagttaaaggagagccgcgagagaacaagaccgttcaggaagcagacgtcccagctaaacccagactagtattttccatttttgcctatttaaaagcaatatttgtagctgtatttttttaaacatgtataaaaaaattttttgaaaagaaagtccatttagcctattgtgcgtcttctctttacctgagggtgactctgcactgaccggcagaaatctgctttacttgggatcgcctacagaatatgttgccaatgcttgtacaagtatgggatcccttctggataacagatcctgtacctgtaccaatatccagttctgctgacaatcacaaacataaacatttttgtatatccatccacccccaccccatccatatgtgtaacatgcttagcattctaaaggctggtaaaggttttttcaataacacactacttactttttcacacggatatttgggttcaatattaatcattaagtggaaacctttttaaaggccaagctgcataaataagcgtggcttgcagtagcggcaaaggtgatttaacagatttattatcttttatgtcttttgccaacataccaaccatgggggtaatataatcgcccttgcaggggaatgactgtactgtaagcgttatacttgctgaacggtgagcttgctttgtcattgtccatatgtcttatgtacattagggaagcattatgggcaatgtaagcctgccagaatctttataaaaaattctgttttctgcacagaaactgttaaaaggtatctgcccatcactagctaagtgacagggcaaacagccacaactgggcccattggagaatattcccacgggtcacaaggctgaattgcatttaaccaatcccaatgcatatttcaacgtgtaaaataattatatgcatacgcagatagaggagaactaaagctaaagaatttgggtagaaatgcaacaccttatgtgcttctgtaccagccccaagccgcctgaagatgcctacagtagcccccccatcttcttttgtgctgattccctgcacatactctgggctgctgcccgttacctgagcttagagatcgactcaccctatacagtatatctaaatgtaaaatgaatcatacaatgctctttagtaatcggttcagattacattgcatggcatgagtgtaacgtcttagcagcagtctagagcccactgagcatgtgcaggtcagtgacacacaaaagatgactttacagaagtgggaattgaattgaacaactttgaaggcctgggtcattattgtaatagagctactgagcctcaacagtaaggtcacacagcatttctaaacatatttttttggctttagttttacatttattgtctgcattattgagctcattcatctcttggtgaaattaaactgactaaatgttcatcttttgttctcgcagcagtactttccattctagatttcatgttttaagcctgtcatctaatttttcacagaataaggcctttgctttactctcatatttgaaagtgtttgcaaataaattttttttaaacctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEAALFIFSLIDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVVPELVGHTVVSVLMLVSLHWFIFILNLPVAAWNIYRFIMVPSGNLGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFIYLYSMILALIND
Donor tissue: tailbud