ORFeome > coe2 – XORFeome 2.0

coe2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis transcription factor coe2, mRNA (cDNA clone MGC:75916 IMAGE:5383656), complete cds
Gene Symbol: coe2
Gene ID: 394808
ORF gb_acc: MG132983
ORF ID: 10363

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063360

Library Location

Plate ID: GDExt11004
Well Location: G09

EST Sequences

Clone: MGC:75916 IMAGE:5383656
Trimmed Sequence: ATGTTTGGGGTCCAGGACACTTTGGCAAGATCAGGAACTGCCTTGAGAGACAAAGCGCTGGGAGTTGGAATGGATCCAGTCCGGTCCTGGGTTCGGAATGTTGGAGTAGTGGATGCCAAGGTGGCAGCTCAGAGTGGGGTGGCAGTGTCCCGGGCTCACTTTGAGAAGCAGCCCCCATCCAACCTGCGCAAATCAAACTTCTTCCATTTTGTGCTGGCTCTGTATGACCGACAGGGGCAGCCAATAGAGATTGAGCGCACAGCCTTTGTGGACTTTGTGGAGAACGAGAAGGAATTAAGCACAGAGAAGACCAATAATGGGACCCACTACAAACTGCAGCTCCTGTACAGCAATGGTGTCCGGACTGAGCAGGATCTCTACGTGAGGCTTATTGACTCGGTGACAAAGCAGCCAATAGCTTATGAAGGTCAGAACAAGAACCCGGAGATGTGCAGGGTGCTGCTCACACACGAGGTCATGTGCAGTCGCTGCTGTGAAAAGAAGAGCTGCGGGAATCGGAATGAGACCCCGTCAGATCCCGTCATCATTGACAGGTTCTTCCTAAAGTTCTTTCTGAAATGTAACCAAAACTGCCTGAAGACTGCAGGGAATCCCAGGGATATGAGACGGTTCCAGGTCGTCCTCTCCACCACCGTGAATGTAGATGGACATGTACTAGCCGTGTCTGATAACATGTTCGTTCACAACAATTCCAAACACGGGAGAAGGGCGAGGCGGCTGGACCCCAGCGAAGCTACGCCGTGCATTAAAGCCATCAGTCCCAGTGAAGGCTGGACAACGGGAGGGGCCATGGTGATAATCATTGGGGACAATTTCTTCGATGGCCTGCAAGTGGTGTTTGGGACAATGCTGGTATGGAGCGAGCTTATCACCCCCCATGCGATCCGGGTGCAGACACCTCCGAGGCACATTCCCGGTGTGGTGGAGGTGACACTGTCCTACAAATCCAAACAGTTCTGCAAAGGAGCCCCGGGGAGGTTTATTTACACAGCTTTAAATGAACCAACAATTGATTATGGATTCCAGAGGCTTCAAAAAGTAATTCCAAGACATCCTGGGGACCCAGAGCGGTTGGCAAAGGAAATGTTATTGAAACGGGCAGCAGATTTGGTGGAGGCGCTCTATGGAACCCCACACAATAATCAGGACATTATTCTGAAGAGGGCAGCTGATATTGCGGAGGCTCTGTACAGTGTTCCTCGGAATCACAATCAAATTCCTGCACTTTCCAGCTCACCAGTGCACAGTGGCATGATGGGGATTAACTCGTATGGGGGACAGCTTGGCGTCAGCATATCAGAGTCACAGGCTAATAACCAGGGTTACATCCGGAACACAAGCAGTATCTCTCCACGAGGATATTCCAGCAGTTCAACCCCACAGCAGTCTAATTACAGCACCCCCAGCAACAGCATGAATGGCTACAGCAACGTCCCCATGTCTAATCTTGGAGTGCCTGGGTCCCCGGGATTCATCAACGGCTCCCCCACCACCTCTCCCTATGGCATTATGCCCTCCAGCCCGCCTGTGGGATCATCTGGAAGCTCATCCATTCTGCCTTTTTCCTCCTCCGTCTTCCCGTCCATTAAACAGAAGAGTGCCTTTGCCCCTGTCATACGACCGCAGGGTTCCCCATCTCCAGCCTGCTCCAGCTCCAACTCAAATGGGTTCCGAGCTATGACAGGCTTGGTGGTGCCCCCCATGTGA
Full Trace Sequence: cggtgttgggtcaggctgaggagcaggtggcacaggaagggcacagggactgcatgttgaggctaccggaacctccccactatttctgagccaacactcaatgtttggggtccaggacactttggcaagatcaggaactgccttgagagacaaagcgctgggagttggaatggatccagtccggtcctgggttcggaatgttggagtagtggatgccaaggtggcagctcagagtggggtggcagtgtcccgggctcactttgagaagcagcccccatccaacctgcgcaaatcaaacttcttccattttgtgctggctctgtatgaccgacaggggcagccaatagagattgagcgcacagcctttgtggactttgtggagaacgagaaggaattaagcacagagaagaccaataatgggacccactacaaactgcagctcctgtacagcaatggtgtccggactgagcaggatctctacgtgaggcttattgactcggtgacaaagcagccaatagcttatgaaggtcagaacaagaacccggagatgtgcagggtgctgctcacacacgaggtcatgtgcagtcgctgctgtgaaaagaagagctgcgggaatcggaatgagaccccgtcagatcccgtcatcattgacaggttcttcctaaagttctttctgaaatgtaaccaaaactgcctgaagactgcagggaatcccagggatatgagacggttccaggtcgtcctctccaccaccgtgaatgtagatggacatgtactagccgtgtctgataacatgttcgttcacaacaattccaaacacgggagaagggcgaggcggctggaccccagcgaagctacgccgtgcattaaagccatcagtcccagtgaaggctggacaacgggaggggccatggtgataatcattggggacaatttcttcgatggcctgcaagtggtgtttgggacaatgctggtatggagcgagcttatcaccccccatgcgatccgggtgcagacacctccgaggcacattcccggtgtggtggaggtgacactgtcctacaaatccaaacagttctgcaaaggagccccggggaggtttatttacacagctttaaatgaaccaacaattgattatggattccagaggcttcaaaaagtaattccaagacatcctggggacccagagcggttggcaaaggaaatgttattgaaacgggcagcagatttggtggaggcgctctatggaaccccacacaataatcaggacattattctgaagagggcagctgatattgcggaggctctgtacagtgttcctcggaatcacaatcaaattcctgcactttccagctcaccagtgcacagtggcatgatggggattaactcgtatgggggacagcttggcgtcagcatatcagagtcacaggctaataaccagggttacatccggaacacaagcagtatctctccacgaggatattccagcagttcaaccccacagcagtctaattacagcacccccagcaacagcatgaatggctacagcaacgtccccatgtctaatcttggagtgcctgggtccccgggattcatcaacggctcccccaccacctctccctatggcattatgccctccagcccgcctgtgggatcatctggaagctcatccattctgcctttttcctcctccgtcttcccgtccattaaacagaagagtgcctttgcccctgtcatacgaccgcagggttccccatctccagcctgctccagctccaactcaaatgggttccgagctatgacaggcttggtggtgccccccatgtgaaagagcgatggactcttattttttcactgaggtgcaagataaaacttcaagttgtggctaaagttggacctgccggcgaggagacttttctttgcttctgtccttgaagtgccaccagtcctcggcgaggagaacacaacatggcatggaattccaacagaatccggaccaggtgcaaacgaacggacagaaaacctgtacagagctgagagttcagcagacgattccatggaatattttggatattttctctcctttgtaggaaaaaaaaaaagaacagtttctattttcagccaaacttttctgataccgacttttacgtttgtccaacgagaagaaaaacaaaaaacgtttttcaatggaagcgaaacagggtactggcaaagggagactctgcgttctttatccgagagcataatcttcttccttcgctgtgacgtctcgacttaaacacttacattttctaatgttttaatttgttttacattatttaaatgaatatacttgtaacttattgtatttagaggtaggaacaaatcgactaaataaagagaagaaatgggaaaaaaaaaaaaaaaaaaaaaaa
Translation: MFGVQDTLARSGTALRDKALGVGMDPVRSWVRNVGVVDAKVAAQSGVAVSRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPIEIERTAFVDFVENEKELSTEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNHNQIPALSSSPVHSGMMGINSYGGQLGVSISESQANNQGYIRNTSSISPRGYSSSSTPQQSNYSTPSNSMNGYSNVPMSNLGVPGSPGFINGSPTTSPYGIMPSSPPVGSSGSSSILPFSSSVFPSIKQKSAFAPVIRPQGSPSPACSSSNSNGFRAMTGLVVPPM
Donor tissue: neurula