ORFeome > col11a2 – XORFeome 2.0

col11a2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis collagen, type XI, alpha 2, mRNA (cDNA clone MGC:89039 IMAGE:7005187), complete cds
Gene Symbol: col11a2
Gene ID: 448277
ORF gb_acc: MG134136
ORF ID: 11764

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075348

Library Location

Plate ID: GDExt11017
Well Location: E02

EST Sequences

Clone: MGC:89039 IMAGE:7005187
Trimmed Sequence: ATGGGAATTTCTCTTCCAAGTCTCTTTTGTCTGATTCTTGTTGGGATCACAATATCCTGCCGTGCCCAAGACACGTGTCCTGATGTAAAACTCATTGGAGTTGGAGAATCAGAAAGAATGGCAATTCTAAGAGGGTGTCCGGGGTCTACGGGATCCCCTGGGCAAAAGGGAGAAGCAGGGACACAAGGAACAAAAGGGAACCCTGGAATCCCTGGAATGTTGGGCCCCCGTGGTGAGAAAGGAGACATTGGGCCTCCTGGACTCTTGGGGCCACCTGGCGAGAGAGGAGACCCTGGAATCCCTGGAATGTTGGGCCCCCGTGGTGAGAAAGGAGACATGGGGCCTCCTGGACCCTCAGGGCCACCTGGCGAGAGAGCTGCTAAGAACTGTATGGAGCTGCTCAATTATGGAGTCTTATTCACCGGCTGGTACACAATCTATCTGGATGGTAATAAGCCTATAAAGGTTCTCTGTGACATGGATACAGATGGAGGGGGATGGATAGTGTTTCAGAGACGAGTGGACGGTTCTGTGGATTTTTACAGAGACTGGAAATCCTACAAACAAGGTTTTGGCAGCCAACTGAGCGAATTCTGGTTGGGAAATGAGAACATTCACCGCCTTACGTCCTCAGGGAATTTCCAACTGCGCTTCGACCTGGAGGATTTCGACAACAATCGAACCTACGCCACCTACAGCCAATTCCGACTGGAGCCAGAGTCTCAGAATTACACCCTACGTTTTAGAGAATTCACTGGGGGCCCTGCAGGAGACTCCTTGTTTACTCACAAGGACAGAGCATTTAGCACAAAGGATGCGGATAATGATCCAGCCAGTAAAACTAACTGTGCAGAACGGTACAAAGGGGCCTGGTGGTACGAGAGTTGTTACCATTCCTGTCTGAATGGGGAATATATGCGAGGACAACACGATAAAGCAGATGGAGGAGTCCACTGGGCCAAATTCAGAGGGGTTAATTACTCCCTGAAAGTGTCTGAAATGAAGCTCCGCCCAGAAAAGTAA
Full Trace Sequence: ctgtgtgattgataaagagccacggatctgtgcagtctcataaatggaaaaaccaccgaccatgggaatttctcttccaagtctcttttgtctgattcttgttgggatcacaatatcctgccgtgcccaagacacgtgtcctgatgtaaaactcattggagttggagaatcagaaagaatggcaattctaagagggtgtccggggtctacgggatcccctgggcaaaagggagaagcagggacacaaggaacaaaagggaaccctggaatccctggaatgttgggcccccgtggtgagaaaggagacattgggcctcctggactcttggggccacctggcgagagaggagaccctggaatccctggaatgttgggcccccgtggtgagaaaggagacatggggcctcctggaccctcagggccacctggcgagagagctgctaagaactgtatggagctgctcaattatggagtcttattcaccggctggtacacaatctatctggatggtaataagcctataaaggttctctgtgacatggatacagatggagggggatggatagtgtttcagagacgagtggacggttctgtggatttttacagagactggaaatcctacaaacaaggttttggcagccaactgagcgaattctggttgggaaatgagaacattcaccgccttacgtcctcagggaatttccaactgcgcttcgacctggaggatttcgacaacaatcgaacctacgccacctacagccaattccgactggagccagagtctcagaattacaccctacgttttagagaattcactgggggccctgcaggagactccttgtttactcacaaggacagagcatttagcacaaaggatgcggataatgatccagccagtaaaactaactgtgcagaacggtacaaaggggcctggtggtacgagagttgttaccattcctgtctgaatggggaatatatgcgaggacaacacgataaagcagatggaggagtccactgggccaaattcagaggggttaattactccctgaaagtgtctgaaatgaagctccgcccagaaaagtaacaggaaatcacttgattattatctgttaattttataaattgattccaagggcgccattattctgtactgtgctattcactgacaaatgtttgaatttttttttaaataaaaaaaacatgcattttaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGISLPSLFCLILVGITISCRAQDTCPDVKLIGVGESERMAILRGCPGSTGSPGQKGEAGTQGTKGNPGIPGMLGPRGEKGDIGPPGLLGPPGERGDPGIPGMLGPRGEKGDMGPPGPSGPPGERAAKNCMELLNYGVLFTGWYTIYLDGNKPIKVLCDMDTDGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQLSEFWLGNENIHRLTSSGNFQLRFDLEDFDNNRTYATYSQFRLEPESQNYTLRFREFTGGPAGDSLFTHKDRAFSTKDADNDPASKTNCAERYKGAWWYESCYHSCLNGEYMRGQHDKADGGVHWAKFRGVNYSLKVSEMKLRPEK
Donor tissue: