ORFeome > commd7 – XORFeome 2.0

commd7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis COMM domain containing 7, mRNA (cDNA clone MGC:75822 IMAGE:5382457), complete cds
Gene Symbol: commd7
Gene ID: 394776
ORF gb_acc:
ORF ID: 10439

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063343

Library Location

Plate ID: GDExt11005
Well Location: F01

EST Sequences

Clone: MGC:75822 IMAGE:5382457
Trimmed Sequence: ATGTCCCTCCGCCATTCCCTGGCGCCGCTTCCCGACTCCTCCGCTCCTGATATCCGCAACCTGCAGCAACTGCATTCCGAGCAGGTCTCCCGTCTGTGCAGCATCATCTTTGGGTTTCTAAAGGGTCAGAAGGAGCAGCCCCATCTCCATTCTCAGCTCGATGATTTTGCCAGAATCAATGGCATCAGCCTTGGGCCGTTGAAAAGCATCGTGAAAAGCATCTTCCTCATCCTCAATGATGCACTGAAAAGGAATGTGAGCGCCGAGCAGCTGAGAAACGATTTGATTGGTTTGGGCCTCGATGAGGAAAAAGCTTCATACTTTGAGCATCAGTGGGGCACTGACCTGTCGCTGCTGAGCTGGATGGCAGCGGAACGAACGTTATTGATAAATCATCTGGTCGACATGGAATGGAAGTTTGGAGTTACAGCCGCCAGCAGCGAGACGGACAAGTCTGGAAGCATCTTTCTACAGCTGAAGATGATGGTGCGGAGGGGCAGTGTCACTGAGCCCATCTATGTAGAGCTGACTCTCCCTCAGTTCTACAGTTTCCTGCATGAGATAGAGCGTGCCAAGAACAGCCTGGAATGCTTCTCCTGA
Full Trace Sequence: gttccggtctgtcctgctgtccgggctgcggggcctgagggccgctttgtaacgggagggggaggcggggaggctactgacacagccggttactgggcagcgggttactgtgccgctaccatgtccctccgccattccctggcgccgcttcccgactcctccgctcctgatatccgcaacctgcagcaactgcattccgagcaggtctcccgtctgtgcagcatcatctttgggtttctaaagggtcagaaggagcagccccatctccattctcagctcgatgattttgccagaatcaatggcatcagccttgggccgttgaaaagcatcgtgaaaagcatcttcctcatcctcaatgatgcactgaaaaggaatgtgagcgccgagcagctgagaaacgatttgattggtttgggcctcgatgaggaaaaagcttcatactttgagcatcagtggggcactgacctgtcgctgctgagctggatggcagcggaacgaacgttattgataaatcatctggtcgacatggaatggaagtttggagttacagccgccagcagcgagacggacaagtctggaagcatctttctacagctgaagatgatggtgcggaggggcagtgtcactgagcccatctatgtagagctgactctccctcagttctacagtttcctgcatgagatagagcgtgccaagaacagcctggaatgcttctcctgaggcgcatcctgtgcccagggcccttacccacgggcacctttcatgtttggccagttcatcgctgtgacaggagctctggagctgtgtgggattcagagataatgggaacttactgggtaccccccccccccaaatacaagtattgaactcacaacaactcctcatcctcctgcagcaaagttacccttcccctccccaagtggcacagcccccactccagctacctacagatttagtctttccttcttacgtgccagtataacccagggctcccctaattcataatagggtaacatatgtgcaaggaaatgttttgtatcacccatcctactcgacttacctaaatatctagagcaacaaataagggccttagctcatggcagggttgcagatgtgtggaggcattggggtggcagtcgccctgctgtggttccgggggtgcccggggcacagatactcgccccgggtccctcccctggctggccttcgggctgggcccccttggcccgtggcagggttgcagatgtgtgggggcattggggtggcggtcgccccgctgtggttccgggggtgcccggggcgcaggtgggcgctcgccccgggtccccccctggctggccttcgggctgggcccccttggcccatggcaaggttgcagatgtgtagaggcattggggtggcggttgccccgctgtggttccgggggtacccggggcacggatgggcactcgccccgggtccccccctggctggccttcgggctgggcccccttggcccatggcaaggttgcggatgtgtaggggcattggggtggcagtcgccccgctgtggttccgggggtgcccggggcgcaggtgggcgctcgccccgggtccccccctggctggccttcgggctgggcccccttggcccatggcggggttgcagatgtgtgggggcattggggtggcggtcgccccgctgtggttccgggggtgcccggggcacgggtgggcgctcaccccgggtcccccctggctggccttcgggctgggcccccttggcccatggcaaggttgcagatgtgtgggggcattggggtggcggtcgccccgctgtagttccgggggtgcccggggcacgggtgggcgctcgccccgggtccccccctggctggccttcgggctgggcccccttggcccgtggcagggttgcagatgtgtgggggcattggggtggcggtcgccccgctgtggttccgggggtgcccggggcacggatgagcactcacccctcactatgcagccctgcaataccggccactcgaataccctaacaatagagaagcaatgtgccatattggggcagatttcatttggttattatggaacataacaagccagtccagccgctgcctctagagttccggggaagcaagagggaccagttgcccagacactgtgttcttaggggtacacactgaccaatccgctctgccagcaactcagtgccatcctccctggccaaccatctgtttgtactggccaatttttttttatgattgcatttcaataaaggacaaatgtaaatcctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSLRHSLAPLPDSSAPDIRNLQQLHSEQVSRLCSIIFGFLKGQKEQPHLHSQLDDFARINGISLGPLKSIVKSIFLILNDALKRNVSAEQLRNDLIGLGLDEEKASYFEHQWGTDLSLLSWMAAERTLLINHLVDMEWKFGVTAASSETDKSGSIFLQLKMMVRRGSVTEPIYVELTLPQFYSFLHEIERAKNSLECFS
Donor tissue: neurula