ORFeome > copz2 – XORFeome 2.0

copz2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis coatomer protein complex, subunit zeta 2, mRNA (cDNA clone MGC:75577 IMAGE:5379111), complete cds
Gene Symbol: copz2
Gene ID: 394893
ORF gb_acc: MG132770
ORF ID: 10080

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064149

Library Location

Plate ID: GDExt11002
Well Location: E06

EST Sequences

Clone: MGC:75577 IMAGE:5379111
Trimmed Sequence: ATGGGGAGCGGCTCTTTGCTAAGTATTATGATGAAACCTATCCCACCGTCAAGGAGCAGAAGGCTTTTGAAAAAAAACATTTTCAATAAAACCCATCGGACAGACAGCGAGATTGCTCTTCTAGAGGGGCTGACTGTGGTGTATAAAAGCAGCATTGACCTGTATTTTTATGTCATTGGAAGCTCACATGAAAACGAGCTTATGCTCATGGCTGTTTTGAACTGTCTCTTTGACTCCTTAAGCCAGATGCTCCGCAAAAATGTCGAAAAGCGAACCCTGCTTGAGAATATGGAAGGACTTTTCCTGGCAGTTGATGAGATTATAGATGGAGGAGTCATACTAGAGAGTGACCCTCAGCAAGTGGTTCACCGTGTGGCACTAAGGGGTGATGACGTTCCTCTCACAGAGCAAACAGTATCACAGGTGCTACAATCTGCAAAAGAGCAAATCAAGTGGTCCCTTCTCCGGTAG
Full Trace Sequence: gtcagcaggatagagaaagatggatgctatactgttggatccttccttgtacacagtgaaagctgttttaattttggacaatgatggggagcggctctttgctaagtattatgatgaaacctatcccaccgtcaaggagcagaaggcttttgaaaaaaaacattttcaataaaacccatcggacagacagcgagattgctcttctagaggggctgactgtggtgtataaaagcagcattgacctgtatttttatgtcattggaagctcacatgaaaacgagcttatgctcatggctgttttgaactgtctctttgactccttaagccagatgctccgcaaaaatgtcgaaaagcgaaccctgcttgagaatatggaaggacttttcctggcagttgatgagattatagatggaggagtcatactagagagtgaccctcagcaagtggttcaccgtgtggcactaaggggtgatgacgttcctctcacagagcaaacagtatcacaggtgctacaatctgcaaaagagcaaatcaagtggtcccttctccggtagttggcgtctgccggcctgcactagtccatcattcattccatctttatggggcccacagctgctgtccttctttgtccccattcttcgaccaattgcattcggccgctaagttagatctcttgcactgacttttttttttttttaatggaatcttgtatttaagtgcattggtgatccaagacccatggtctcatgtcttctaagattgtttgtttttccttttacaaatgtttcatttatttcctcccaaagcaaagaattcagttgtactcatacagtagtttaggaatctgaaatgtcccaatgggtttctatgggaagctgcagagtagtatagctttgcacacattcacttagcagcgcctgtgcccagcctcgcagtatggcctaaatcaagccttcactttcacttgatgtaaataaatgatgtcccattctcagtaggtaagaggaattttatcgagatcattcatcaggtttctgctctggcagaacaattcttgtgtgttttgcttcctgagacctctaagtgccaaatgaacggatcatttgcattcagtagggtaggcggtaactcacacatcacaaaccatgaatatgataaacagactctcttgccttctgttagagggaaaccttgttaaagtggaccaacgtgatgcattcaaagcatattttcttgctgtccttataccaactaatacataagatgaataaatgccataccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGSGSLLSIMMKPIPPSRSRRLLKKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSHENELMLMAVLNCLFDSLSQMLRKNVEKRTLLENMEGLFLAVDEIIDGGVILESDPQQVVHRVALRGDDVPLTEQTVSQVLQSAKEQIKWSLLR
Donor tissue: tailbud