ORFeome > coro1c – XORFeome 2.0

coro1c – XORFeome 2.0

General Information

Species: Xenopus tropicalis coronin, actin binding protein 1C, mRNA (cDNA clone MGC:76199 IMAGE:5335983), complete cds
Gene Symbol: coro1c
Gene ID: 395017
ORF gb_acc: MG132798
ORF ID: 10129

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064872

Library Location

Plate ID: GDExt11002
Well Location: A01

EST Sequences

Clone: MGC:76199 IMAGE:5335983
Trimmed Sequence: ATGAGACGCGTGGTGCGACAAAGCAAGTTCCGGCACGTCTTCGGGCAAGCTCTGAAGAACGACCAATGCTACGATGATATACGGGTCTCACGTGTTACTTGGGACAGCTCTTTCTGTGCTGTCAACCCCAACTTTGTTGCCATAATTATTGAAGCAAGTGGTGGGGGGGCCTTTCTGGTGTTGCCTCTACAAAAGTCTGGAAGAATTGACAAATCCTACCCAACAGTATGTGGCCACACAGGACCAGTGCTGGACATTGACTGGTGTCCACACAATGACAATGTTATTGCCAGTGGCTCTGAAGATTGCACAGTCATGGTATGGCAGATCCCAGAGAATGGCTTGACTATTCCACTCACGGATCCTGTGGTGGTGCTGGAAGGACATTCCAAGCGAGTTGGCATTGTCACGTGGCATCCAACTGCGCGTAATGTATTGCTTAGTGCAGGATGTGATAACGCCATCTTCATTTGGAATGTGGGCACTGGAGAGGCCATGTTTAACTTGGAAGATATGCACAATGATATGATCTACAGTGCATGCTGGAACCGTAATGGAAGCCTTATCTGCACAGCCTCTAAAGACAAGAAGCTTCGTGTAATAGATCCACGCAAGATGGAAGTGGTATCGGAGAAAGATAAAGCTCACGAAGGTGCCCGGCCTATGAGAGCAATCTTTTTAGCTGATGGAAACATCTTTACTACAGGGTTCAGTCGTATGAGTGAACGTCAGCTAGCACTGTGGAATCCAAAAAATATGGAAGAGCCAATTGCACTACATGAAATGGACACTAGCAATGGAGTTTTGCTACCATTTTATGATCCAGACACAAGTATCATTTACTTGTGTGGAAAGGGTGATAGCAGTATTCGGTATTTTGAAATCACAGATGAGTCTCCATATGTTCACTACCTCAACACATTCAGCAGTAAGGAACCACAGCGAGGGATGGGCTATATGCCAAAGAGAGGGTTGGATGTCAACAAGTGTGAAATTGCCAGGTTCTACAAATTGCATGAGAGGAAGTGCGAGCCAATCATCATGACTGTTCCCAGGAAGTCTGACCTTTTCCAAGATGATCTTTACCCTGATACTGCTGGACCAGAGGCTCCTATAGAGGCAGAGGACTGGTTTGATGGGAAAAACGCAGACCCCGTATTGATTTCCCTAAAGCAGGGGTATGTGCCAACCAAAGGCAGAGACCTTAATGTGGTTAAGAAGAATATCCTTGGCAGCAAGCCAGCAGCCCATAAAAAGGCTGAACCAGCCAGCACCCCCAAAAAGATGACTGAAACTCCCCATCCAGCAAGTGATGGCAAGATGGATGACGTCATGAAGGAACTTCGGTCAATGAAAGAGACCATTCGGTACCAAGGGGAAAGGATTGCCAAGCTAGAACAATTAGTTGCCAGTCTCAACACCAATGATGAGTCAGAAGAATGA
Full Trace Sequence: attttgagtgcgggaagggtgaagtgtgagtgcctcttccctcaacccagtcagaaagacgacaaggacccactcccggcatatacgagccactccaaaggagggcaccaagaagagatcattgagtcagataaaatgagacgcgtggtgcgacaaagcaagttccggcacgtcttcgggcaagctctgaagaacgaccaatgctacgatgatatacgggtctcacgtgttacttgggacagctctttctgtgctgtcaaccccaactttgttgccataattattgaagcaagtggtgggggggcctttctggtgttgcctctacaaaagtctggaagaattgacaaatcctacccaacagtatgtggccacacaggaccagtgctggacattgactggtgtccacacaatgacaatgttattgccagtggctctgaagattgcacagtcatggtatggcagatcccagagaatggcttgactattccactcacggatcctgtggtggtgctggaaggacattccaagcgagttggcattgtcacgtggcatccaactgcgcgtaatgtattgcttagtgcaggatgtgataacgccatcttcatttggaatgtgggcactggagaggccatgtttaacttggaagatatgcacaatgatatgatctacagtgcatgctggaaccgtaatggaagccttatctgcacagcctctaaagacaagaagcttcgtgtaatagatccacgcaagatggaagtggtatcggagaaagataaagctcacgaaggtgcccggcctatgagagcaatctttttagctgatggaaacatctttactacagggttcagtcgtatgagtgaacgtcagctagcactgtggaatccaaaaaatatggaagagccaattgcactacatgaaatggacactagcaatggagttttgctaccattttatgatccagacacaagtatcatttacttgtgtggaaagggtgatagcagtattcggtattttgaaatcacagatgagtctccatatgttcactacctcaacacattcagcagtaaggaaccacagcgagggatgggctatatgccaaagagagggttggatgtcaacaagtgtgaaattgccaggttctacaaattgcatgagaggaagtgcgagccaatcatcatgactgttcccaggaagtctgaccttttccaagatgatctttaccctgatactgctggaccagaggctcctatagaggcagaggactggtttgatgggaaaaacgcagaccccgtattgatttccctaaagcaggggtatgtgccaaccaaaggcagagaccttaatgtggttaagaagaatatccttggcagcaagccagcagcccataaaaaggctgaaccagccagcacccccaaaaagatgactgaaactccccatccagcaagtgatggcaagatggatgacgtcatgaaggaacttcggtcaatgaaagagaccattcggtaccaaggggaaaggattgccaagctagaacaattagttgccagtctcaacaccaatgatgagtcagaagaatgagcagtccatattcctgaataagctggaggatcccactgccagaacagattcccttcacattcctccaggcccaaatgatcagcattccgagaaaacagaccattccctttatttcactgagactttccaaatacccccttgaaccaggtgcctctcttaagaccctaattgtgccacttcagaagtattgcttgagaatccaacttctgaggtgtcataatccacatttcagctcgtattttctttcttaaacaagaccatattccaaaggaagaaatatagaccaacatcccccccccccccactcatacattaaaagccaagtttttttttacccttagctataaagtgttacatgacaatattttcctgattccaccatcagtacaatatatagagattttttttaattatcatttttgttctgaaattgattttcagggaaggtgatatagaggtgatatagatggaccaatgccacactattttgttttcttttgccaaaaagacctttctgtgaggttgttatattgggaccatgcatcttatattttttatttttaatgtaaagcagaaagcactgtgttacactgtctggaattgcgagaatagtaattacccataacagcttcatgagttttatataaatctttttgctattaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRRVVRQSKFRHVFGQALKNDQCYDDIRVSRVTWDSSFCAVNPNFVAIIIEASGGGAFLVLPLQKSGRIDKSYPTVCGHTGPVLDIDWCPHNDNVIASGSEDCTVMVWQIPENGLTIPLTDPVVVLEGHSKRVGIVTWHPTARNVLLSAGCDNAIFIWNVGTGEAMFNLEDMHNDMIYSACWNRNGSLICTASKDKKLRVIDPRKMEVVSEKDKAHEGARPMRAIFLADGNIFTTGFSRMSERQLALWNPKNMEEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAPIEAEDWFDGKNADPVLISLKQGYVPTKGRDLNVVKKNILGSKPAAHKKAEPASTPKKMTETPHPASDGKMDDVMKELRSMKETIRYQGERIAKLEQLVASLNTNDESEE
Donor tissue: tailbud