ORFeome > cox4nb – XORFeome 2.0

cox4nb – XORFeome 2.0

General Information

Species: Xenopus tropicalis COX4 neighbor, mRNA (cDNA clone MGC:75783 IMAGE:5381969), complete cds
Gene Symbol: cox4nb
Gene ID: 394788
ORF gb_acc: MG132946
ORF ID: 10320

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063338

Library Location

Plate ID: GDExt11004
Well Location: G04

EST Sequences

Clone: MGC:75783 IMAGE:5381969
Trimmed Sequence: ATGCCAGCATTTAAGTTAACAACACAGGCTTTCTGCAAAATGATGCTTCATAGCGCAAAATACCCATACTGTACTGTCAATGGCATTTTGGTGGCTCAGAAGCAAAAGCGCAAAGATGGTCATCAGCAAGTCCTGTTTGTAGACTGTATCCCACTCTTTCACGGCACTGTTGCTTTGGCACCTGTACTGGAAGTTGCATTAACACTGATAGATACCTGGTGCAAAGAGAATGACTATGTGATTGCTGGATATTACCAAGCAAATGAACGTCTAAAAGACACCAGTCCAAACCAAGTGGCTGAAAGAATAGCGTCACGGATAGCTGAAGGCTTTAATGATGCCGCTTTAATAATGGTAGACAACAGTAAGTTCTCCATGGAATGTATAAGTCCTTCCTTTCATGTGTATGAGCACCATGATAACAGGTGGAAAAGCAGAGACCCACATGAGGATTTATTTGAAGACTGGCCAGAAGCTCAGAAAATTACTGCATCGCTCCTAGACAGCAGGTCATATGAAACTCTTGTGGATTTTGATAGTCATCTTGATGATCTGCGGAATGACTGGGCCAACCCAGATATCAACAAGTCCATTCTTCATCTATGCTAA
Full Trace Sequence: ctttgcggctgcgtgctagtgcgaaggttcacggtgcaaaaatattctaggccggggtattgcttaccggaagcaaccggggaaaagaaggagggagaggagcggaggaaatatgaaggcccagtaaccggagtgtggcactgctcttcggattcaagcattaggctgtaatagttgggcctgctcggtcattcatcgctggaccctcagtcactaatacgggaaaatgccagcatttaagttaacaacacaggctttctgcaaaatgatgcttcatagcgcaaaatacccatactgtactgtcaatggcattttggtggctcagaagcaaaagcgcaaagatggtcatcagcaagtcctgtttgtagactgtatcccactctttcacggcactgttgctttggcacctgtactggaagttgcattaacactgatagatacctggtgcaaagagaatgactatgtgattgctggatattaccaagcaaatgaacgtctaaaagacaccagtccaaaccaagtggctgaaagaatagcgtcacggatagctgaaggctttaatgatgccgctttaataatggtagacaacagtaagttctccatggaatgtataagtccttcctttcatgtgtatgagcaccatgataacaggtggaaaagcagagacccacatgaggatttatttgaagactggccagaagctcagaaaattactgcatcgctcctagacagcaggtcatatgaaactcttgtggattttgatagtcatcttgatgatctgcggaatgactgggccaacccagatatcaacaagtccattcttcatctatgctaagataatagagatttctggtgtggtccatgctatgcaagatgacctctgaatgtagaatctgttgttaagcaacatctctacctaggtgtgaagaggcataaggaagctggaaaagttctcaagctgttggccttccccactaagaagccaatgctgtttttcttcatgccacagagaataatgaactagccagcaaagtctgaaaatgtttgaccttttcaatgaaggttttgtgtgccgtttttctacaaacccaagaggatcatttctaattctatcaattttctcaaaccacatcaaagaaagtggatttaacacagacttcaatatgttcagttgtaatttttaactcttataatatggaggcttaaacaatgcatttttaagaaactggctatgctaagacatggatgccctaaatgttctaacaaagcatttaatttgttgctacatacaccgtaaagattaccttgattgttgtggaatttgcaccagatgattagatccctcaacccatgtgttttgttttgttttttttaaattttttagaactacatgaattagcttaattcatttaacaagatcctagttgtcatagacttaaaggattttgttgcttcccatcagtataatacactagttttagtgtgtttctcagatgtttgcaaatagctcacttggctgaccattatgttttttatgttacaaattattttacaaaatttacgcatatccaacctcagttcacctttttttttttaataaaccttttttcaataatcaaagtgatttatttttccttaatctgaaaggcataccccatattttgttttgattattgtatctccaaataatttaaagtctaaaataaaattcacttgaagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPAFKLTTQAFCKMMLHSAKYPYCTVNGILVAQKQKRKDGHQQVLFVDCIPLFHGTVALAPVLEVALTLIDTWCKENDYVIAGYYQANERLKDTSPNQVAERIASRIAEGFNDAALIMVDNSKFSMECISPSFHVYEHHDNRWKSRDPHEDLFEDWPEAQKITASLLDSRSYETLVDFDSHLDDLRNDWANPDINKSILHLC
Donor tissue: tadpole