ORFeome > cplx2 – XORFeome 2.0

cplx2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cplx2 protein, mRNA (cDNA clone MGC:79539 IMAGE:6978094), complete cds
Gene Symbol: cplx2
Gene ID: 493222
ORF gb_acc: MG133549
ORF ID: 11079

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079932

Library Location

Plate ID: GDExt11010
Well Location: A07

EST Sequences

Clone: MGC:79539 IMAGE:6978094
Trimmed Sequence: ATGGATTTTGTAATGAAACAGGCCTTAGGGGGGGCCACAAAGGACATGGGGAAGATGTTGGGAGGAGAAGAGGAAAAGGATCCTGATGCTCAGAAAAAGGAAGAGGAGAGGCAAGAAGCTCTGCGGCAGCAAGAGGATGAACGGAAGGCTAAGCATGCCAGAATGGAGGCAGAGAGAGAAAAAATCAGACAACAAATACGAGACAAGTATGGTCTGAAGAAGAAGGAAGAGAAAGAAGCAGAGGAAAAAGCAGCCTTGGAGCAGCCTTGTGAGGGCAGTTTGACACGTCCTAAGAAAGCAATTCCAGCTGGTTGTGGAGATGATGATGAAGAGGAGGAAGAAAGCATTTTGGACACTGTACTCAAGTACCTCCCAGGACCACTTCAGGACATGTTCAAAAAGTAA
Full Trace Sequence: gtgggagcagtcggacagctggggacgcgctctgtatcctggaagcgttttactcttgtctccaacatttcagcagagaaatacagctttactccaatagctgtactgaatgcgaatttccctgtgaccagtaggatctaactccaagagcgaaaatggattttgtaatgaaacaggccttagggggggccacaaaggacatggggaagatgttgggaggagaagaggaaaaggatcctgatgctcagaaaaaggaagaggagaggcaagaagctctgcggcagcaagaggatgaacggaaggctaagcatgccagaatggaggcagagagagaaaaaatcagacaacaaatacgagacaagtatggtctgaagaagaaggaagagaaagaagcagaggaaaaagcagccttggagcagccttgtgagggcagtttgacacgtcctaagaaagcaattccagctggttgtggagatgatgatgaagaggaggaagaaagcattttggacactgtactcaagtacctcccaggaccacttcaggacatgttcaaaaagtaaccatgaccacattttgagacttctgctccagccaaactcatgttctgctataagcaaaaagaaagccaatcaaatccttgactaagaaagaaattctctcacaaaagaacacactcaacatatgactgcctacacacagacaaaccgttacatacaaatgcattggcccacacatgtttagagatgcaaaaaaatgacttctcttattaacctttttttttcaaaaaaatgactcttactgcctattttatgttgtatggaccaaatttgtcaatgatatataaaatcagagacaaggtttacaaacctgcccacttggtagctaaataaaaaatgcacaagaagggtaggattactattactattactaagggaacaagggttaactttactctttatatatattagctaaataataactgcctaaaacagcttgagcactataatctaatccatctaataacaacaagtgcacaaaacatgcctcctgcaagggtacaaggagatgaaaagtgacgagttcagctgtagatccacaagcacttttgtggcatctgtttgggagtttgggatcttttgggaaaagactatggagaaacccagttgtatttccattggtcctttactcagcatgttggatttgtgtcactttttactcaccttttcttgtctcagcaaaattatcaacaccggcactagatatctctgccaatgtctttctgacgcctttcctaaagagatgcattcctacacactattaaacaaccaatggtgcgacatattatagaccaatctaaactgtacatcttttatcaatggttggccttcaaaagacagcaatgaaagataatgcttgaggccttgagctgaacttcacatggactctgattaggaccaagagacttctattttagatttttatgactgtaatgctgattgcatgcttaggggaaagaaatatatgagtttgatgcctttttcttttgggaaattgcgaatactgtctgtctttgtcctatgccataacacacagttattgtttacatatgtaacataagaacttgagtagaactctttgtagaatattcattcatgtatgtctgtacatacccgcttcttcttttgtttgtccttcctgtccctcaaacaaaggatgggatgtttaatgcagttaccactgatttttttttctgtaatcaaaccaaagtgatatgtcactttatgtgtcctcgtattgttatggtcttcacatgtgtttttgccttgttcagtgcaacacagatcattgatttggttgtcatggaccaaactagataaaaaaagaatatttaactttaaaaaaaaaaaaaaaaaaaaa
Translation: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEDERKAKHARMEAEREKIRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDDDEEEEESILDTVLKYLPGPLQDMFKK
Donor tissue: tailbud