ORFeome > crbn – XORFeome 2.0

crbn – XORFeome 2.0

General Information

Species: Xenopus tropicalis crbn protein, mRNA (cDNA clone MGC:89362 IMAGE:6988306), complete cds
Gene Symbol: crbn
Gene ID: 493554
ORF gb_acc: MG133895
ORF ID: 11485

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082517

Library Location

Plate ID: GDExt11014
Well Location: A04

EST Sequences

Clone: MGC:89362 IMAGE:6988306
Trimmed Sequence: ATGGCTGACGACGAAGGCGAGGAGGATCCCGGCATCAATAACATGGGCAATCTGCTGCAAGTTATAAGCTCGGAGAGTGAAGAGGAAGATGAAATGGAGTTGGAAGATGCAAAAACTGCGGACAGTGAATCCCCGAATATCATCAATTTTGACACCAGCTTGCCAACATCGCATGCATATCTTGGGGTGGACATGGAAGAGTTCCATGGACGGACACTGCATGATGATGACAGCTGCCAACAGATTCCAGTACTGCCCCATGTTCAGGTCATGCTGATTCCAGGGCAGACTCTGCCTCTCCATCTTTCCAGGCCACAAGAGGTCAGCATGGTGCGTGGTCTTATTCAGAGGGACAGAACATTTGCTGTGCTTGCATACAGTGATGGCCTTCAGAGAGAAGCACACTTTGGAACTACTGCCGAAATCTACGCATATCGAGAAGAGCATGAGTTTGGGATTGAGACTGTAAAAGTGAAAGCAATTGGAAGGCAGAGGTTTCAGGTGTTGGAAACAAGAACTCAGGCTGATGGGATCCAGGTGGCTCGGGTGCAGATTCTTCCAGAGAGGGTTTTACCCTGTCCCATGACATCTCTGCAATTGGACTCTCAGAGTCGGCATCTGCTGTTCCCAACAAACAAGCCAGTGAGCGGCCGAAGCCCACAGAGCAAATGCCAGTGGCTGCACAAGTACCGCAGGAGGAAGTTCCTTGGTGCCAGTCTGACCTCCTGGCCTTCCTGGCTGTATGCTCTGTATGATGCAGATTCCCTTATGGAACGAGTGAAACTACAGCTGCATGAGTGGGATGAGAATCTGCGGGATGATTCTCTGCCAGCCAATCCGATTGATTTCTCTTACCGGGTTGCAGCCTGTCTCCCTATTGATGATGCTTTACGTATCCAGCTTTTGCAGATTGGAAATGCCATACAGCGTCTGCGCTGTGAGCTTGACATTATGAGCAAATGTACATCGCTGTGTTGTAAGCACTGTCCCGACACAGAGATCACCACAAAGAATGAGATCTTTAGCTTATCACTTTGTGGTCCGATGGCTGCATATGTGAATCCTCATGGTTACGTTCATGAGACTCTGACTGTCTACAAAGCCTTTAATCTGAGCTTGGTGGGTCGTCCTTCCACAGAGAACAGCTGGTTCCCAGGGTTCGCTTGGACTATTGCACAATGTAGGGTCTGCGGGAGTCACATGGGATGGAAATTCACTGCAGTGCGGAAAGATCTGTCACCTCAGAAGTTTTGGGGCTTGACTCGTTCAGCTTTGCAGCCTCGAATCCCAGAGCCAGATGAAGGGGAAATGGGGCATGATCACTCCCCAATCCTGTGCCTGTGA
Full Trace Sequence: ctggtaaacagcaatggctgacgacgaaggcgaggaggatcccggcatcaataacatgggcaatctgctgcaagttataagctcggagagtgaagaggaagatgaaatggagttggaagatgcaaaaactgcggacagtgaatccccgaatatcatcaattttgacaccagcttgccaacatcgcatgcatatcttggggtggacatggaagagttccatggacggacactgcatgatgatgacagctgccaacagattccagtactgccccatgttcaggtcatgctgattccagggcagactctgcctctccatctttccaggccacaagaggtcagcatggtgcgtggtcttattcagagggacagaacatttgctgtgcttgcatacagtgatggccttcagagagaagcacactttggaactactgccgaaatctacgcatatcgagaagagcatgagtttgggattgagactgtaaaagtgaaagcaattggaaggcagaggtttcaggtgttggaaacaagaactcaggctgatgggatccaggtggctcgggtgcagattcttccagagagggttttaccctgtcccatgacatctctgcaattggactctcagagtcggcatctgctgttcccaacaaacaagccagtgagcggccgaagcccacagagcaaatgccagtggctgcacaagtaccgcaggaggaagttccttggtgccagtctgacctcctggccttcctggctgtatgctctgtatgatgcagattcccttatggaacgagtgaaactacagctgcatgagtgggatgagaatctgcgggatgattctctgccagccaatccgattgatttctcttaccgggttgcagcctgtctccctattgatgatgctttacgtatccagcttttgcagattggaaatgccatacagcgtctgcgctgtgagcttgacattatgagcaaatgtacatcgctgtgttgtaagcactgtcccgacacagagatcaccacaaagaatgagatctttagcttatcactttgtggtccgatggctgcatatgtgaatcctcatggttacgttcatgagactctgactgtctacaaagcctttaatctgagcttggtgggtcgtccttccacagagaacagctggttcccagggttcgcttggactattgcacaatgtagggtctgcgggagtcacatgggatggaaattcactgcagtgcggaaagatctgtcacctcagaagttttggggcttgactcgttcagctttgcagcctcgaatcccagagccagatgaaggggaaatggggcatgatcactccccaatcctgtgcctgtgaatcctgaatcagggactgctttatcactgctctgctttctcttgtcttgctgacaaatgtccttatctctgcgcaagaaagatgctctgcaggtatggggttctgcatgtgtcccagcatgtgagaccatgttgctgataaagaggtacctgtcctgtaattgagccctttgtaagtaagtatggagaagggctgtcactgtatgcctttctgattggcaggcccggactggcaatctgtgggttctggcgggtgccggaggggctgctgtgagatgccatggacactcactgtttgttgggctggtgggggtctgtttgggcctctgtgtgcttgaagtgccagggcctattttaaatcccagtccgggcctgctgatcgggaatgttaaaaccagcacagtctgctatatgttctccctgcgcattgctagtatcaaaacttcttatccctgtagaacaaaacctctgtttcattgtatctcaacatagacaccctctgaaacaatggaaatgtctggaatgtttcctcatacacttattcagcttccaaacagatttagttacaatggatgtaacacctaggattcttttaatgatttttgaggccaaaaaatatttttgtaatatatttaattttttagactccgatatatctaccaaaagaaaggaaaaaaaaaaaaaaagtcccctgaccctcctgccgtatggtcacaactctggatttatgggtgcttctccctaataccaataaatctggtctcagcatgttggcaaaaaaataaaaaaaaaaaaaaaaaaaa
Translation: MADDEGEEDPGINNMGNLLQVISSESEEEDEMELEDAKTADSESPNIINFDTSLPTSHAYLGVDMEEFHGRTLHDDDSCQQIPVLPHVQVMLIPGQTLPLHLSRPQEVSMVRGLIQRDRTFAVLAYSDGLQREAHFGTTAEIYAYREEHEFGIETVKVKAIGRQRFQVLETRTQADGIQVARVQILPERVLPCPMTSLQLDSQSRHLLFPTNKPVSGRSPQSKCQWLHKYRRRKFLGASLTSWPSWLYALYDADSLMERVKLQLHEWDENLRDDSLPANPIDFSYRVAACLPIDDALRIQLLQIGNAIQRLRCELDIMSKCTSLCCKHCPDTEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKAFNLSLVGRPSTENSWFPGFAWTIAQCRVCGSHMGWKFTAVRKDLSPQKFWGLTRSALQPRIPEPDEGEMGHDHSPILCL
Donor tissue: gastrula