ORFeome > crp.2 – XORFeome 2.0

crp.2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis C-reactive protein, pentraxin-related, gene 2, mRNA (cDNA clone MGC:107746 IMAGE:7002773), complete cds
Gene Symbol: crp.2
Gene ID: 496975
ORF gb_acc: MG134603
ORF ID: 12327

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088812

Library Location

Plate ID: GDExt11022
Well Location: B10

EST Sequences

Clone: MGC:107746 IMAGE:7002773
Trimmed Sequence: ATGAGTGACAAGGTGTTTTTCATCCCCAAAGAATCTGCCACATCTTACGTGCGTCTTAATCCAATGAAAAATGGTCCTTTTGCCAGCCTTACAGTTTGTCTAAAATCATATACAACACTGACACGGGCTCATTCACTCTTCTCTTTGGCAACACCAAACAAAGACAATGACTTCCTCCTGTTTCAGGATAAAAATAATAAGTTTTCTGTATCAATAGGCAACCAAGATTGGTATTTGGATATACCAGGCACTGCAGTAGTGAGGAGCATCTGTGCCAGCTGGGATTCTCTGACTGGAGATGCGGTTGTATGGGTCAATGGCAACCCATACCCTAGAAATATATTTATGAAAGGGTACAAAGTCAATGCCAACCCCATCATTATCATTGGACAGGAACAGGATAGTTATGGTGGAAAGTTTGATGCTGCTCAGTCCTTGGTAGGAGAGATAAGTGATGTTCATATGTGGGATAGAGTCCTGACCTCTCAGGAACTTAAGCTGGTACTGTATAACAGGGGCATGGTTGGCGATGTAATTAACTGGCAAAACTTAAACTATGAAACAAAAGGTGAAGTCATTATACTTCCACAAGTATGTAAAATTCATTACTACCCTGATTCTTGCTATAATCCTACAGAAGAACATGTCTATGTATAA
Full Trace Sequence: agaagttttccactgccagacaaccttgagttcagatccaggaaatggagaagacaattgttattatattaatccttgtgagtgcttcagggatcctgactcagacggatatgagtgacaaggtgtttttcatccccaaagaatctgccacatcttacgtgcgtcttaatccaatgaaaaatggtccttttgccagccttacagtttgtctaaaatcatatacaacactgacacgggctcattcactcttctctttggcaacaccaaacaaagacaatgacttcctcctgtttcaggataaaaataataagttttctgtatcaataggcaaccaagattggtatttggatataccaggcactgcagtagtgaggagcatctgtgccagctgggattctctgactggagatgcggttgtatgggtcaatggcaacccataccctagaaatatatttatgaaagggtacaaagtcaatgccaaccccatcattatcattggacaggaacaggatagttatggtggaaagtttgatgctgctcagtccttggtaggagagataagtgatgttcatatgtgggatagagtcctgacctctcaggaacttaagctggtactgtataacaggggcatggttggcgatgtaattaactggcaaaacttaaactatgaaacaaaaggtgaagtcattatacttccacaagtatgtaaaattcattactaccctgattcttgctataatcctacagaagaacatgtctatgtataaagggctctgtaactgcctagtaggtcttacaggaaatgattcttttgatattattgctgttacaccctaaacctctctttataaataaacagacacgtgcaaataaaataatgcatgtttaatgaatgtataattaaatggagtgtagaacaaaatgtttattttgagcctcctttacatatatccatttatttgtagactaggcttccttatagtactctatctcctcctgagtctgttacagatttaattgacttatccagcatataatttttatcttgtagctcttacacccaccctcaattgattatttatttaatcgactgatcctgtgtatatatatatatattttttagcataattaatgtgtagttctcatacctaccctcaaatgaattaatatattgtgctaatttcattccctaatgaactgataggtttagttattttattaccctactcaaggttttttaattgaatctctgattgttgttttattattctatgtattgcaacttttttctttttattgaatgtttagtgtacttatttgatattttttaatgtaatgatttattatataataaaacactgattgattgataaatttaaaaaaaaaaaaaaaaaaaaaaaaaaaagg
Translation: MSDKVFFIPKESATSYVRLNPMKNGPFASLTVCLKSYTTLTRAHSLFSLATPNKDNDFLLFQDKNNKFSVSIGNQDWYLDIPGTAVVRSICASWDSLTGDAVVWVNGNPYPRNIFMKGYKVNANPIIIIGQEQDSYGGKFDAAQSLVGEISDVHMWDRVLTSQELKLVLYNRGMVGDVINWQNLNYETKGEVIILPQVCKIHYYPDSCYNPTEEHVYV
Donor tissue: