ORFeome > ctsd – XORFeome 2.0

ctsd – XORFeome 2.0

General Information

Species: Xenopus tropicalis cathepsin D (lysosomal aspartyl protease), mRNA (cDNA clone MGC:76043 IMAGE:5385037), complete cds
Gene Symbol: ctsd
Gene ID: 394561
ORF gb_acc: MG133507
ORF ID: 11031

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061433

Library Location

Plate ID: GDExt11010
Well Location: E06

EST Sequences

Clone: MGC:76043 IMAGE:5385037
Trimmed Sequence: ATGGCTTCCGCGCCGGTGTGGGCACTGCTGGCTCTCTGCTGCGTCATGCAGCCCGGCTCTTCGCTCGTCAGGATCCCACTGAAGAAATTCACCTCCATACGCCGCGCTATGTCAGAAACCGACCAGGATGCGCTGAAGTTGAGTGGAAATGAAGCTGCCACAAAATATTCTGCTTTTCTCAATAGCAAGAATCCCACCCCAGAGACACTGCTGAATTATTTAGATGCGCAGTACTATGGCGAGATTGGCATCGGTACTCCTCCTCAGCCATTCACTGTGGTGTTCGACACGGGATCCTCTAACCTCTGGGTGCCATCAATCCACTGCTCCTTTTGGGATTTGGCTTGCTGGTTGCACCACAAGTACGATTCCTCCAAATCCACCACCTACATCAACAACGGCACAGAGTTTGCCATCCAGTATGGCAGCGGGAGCCTGACTGGCTACCTGAGTAAGGACACCGTAACGATTGGAGACTTGGCAGTAAATGGGCAGTTTTTTGCAGAAGCCATTAAGCAGCCTGGCATTACCTTTGTAGCAGCCAAATTTGATGGCATCTTAGGTATGGGTTACCCCAAAATCTCTGTGGATGGAGTCCCTCCTGTGTTTGATGATATCATGGAGCAAAAGCTGGTGGATAGTAACATCTTCTCTTTCTATCTAAATCGGAACCCAGACACACTGCCTGGGGGAGAGCTGTTACTAGGAGGCACAGACCCCGCATTTTACACTGGGGACTTCAACTACATGAATGTGACTCGGAAGGCCTACTGGCAGATTCACATGGACCAGCTGAGTGTTGGGGATCGGCTTTCCCTCTGTAAGGATGGCTGCGAAGCTATTGTGGACACAGGAACCTCGTTAATCACCGGGCCGGTAGAAGAAGTGACAGCTTTGCAGAGAGCTATCGGGGCTATCCCACTGATTTGCGGAGAGTATATGATCCTCTGTGATAGTATCCCATCACTTCCTGTCATCAGCTTCACATTTGGAGGTCGGGCATACTCCCTAACAGGGGAACAGTATGTGCTAAAGATTTCAAAGGCTGGTCGCACCGTCTGCCTCAGTGGCTTCTTGGGCCTTGACATCCCTCCTCCGGCCGGGCCCCTCTGGATAATAGGAGACGTTTTCATTGGCCAGTATTACACTGTTTTTGACCGTGCTAATGACCGTGTGGGTTTTGCTAAAGCAAAGTGA
Full Trace Sequence: gttatcacctgatcctgatcacgtgttctgcctgctagcgccaagcgagacggagagagtgagtagttggaagcgcagtttcaggcggcgctatggcttccgcgccggtgtgggcactgctggctctctgctgcgtcatgcagcccggctcttcgctcgtcaggatcccactgaagaaattcacctccatacgccgcgctatgtcagaaaccgaccaggatgcgctgaagttgagtggaaatgaagctgccacaaaatattctgcttttctcaatagcaagaatcccaccccagagacactgctgaattatttagatgcgcagtactatggcgagattggcatcggtactcctcctcagccattcactgtggtgttcgacacgggatcctctaacctctgggtgccatcaatccactgctccttttgggatttggcttgctggttgcaccacaagtacgattcctccaaatccaccacctacatcaacaacggcacagagtttgccatccagtatggcagcgggagcctgactggctacctgagtaaggacaccgtaacgattggagacttggcagtaaatgggcagttttttgcagaagccattaagcagcctggcattacctttgtagcagccaaatttgatggcatcttaggtatgggttaccccaaaatctctgtggatggagtccctcctgtgtttgatgatatcatggagcaaaagctggtggatagtaacatcttctctttctatctaaatcggaacccagacacactgcctgggggagagctgttactaggaggcacagaccccgcattttacactggggacttcaactacatgaatgtgactcggaaggcctactggcagattcacatggaccagctgagtgttggggatcggctttccctctgtaaggatggctgcgaagctattgtggacacaggaacctcgttaatcaccgggccggtagaagaagtgacagctttgcagagagctatcggggctatcccactgatttgcggagagtatatgatcctctgtgatagtatcccatcacttcctgtcatcagcttcacatttggaggtcgggcatactccctaacaggggaacagtatgtgctaaagatttcaaaggctggtcgcaccgtctgcctcagtggcttcttgggccttgacatccctcctccggccgggcccctctggataataggagacgttttcattggccagtattacactgtttttgaccgtgctaatgaccgtgtgggttttgctaaagcaaagtgatgtctcccgtgctctactcactggcataatcaccccctccctttttgaagatctatttttccaataatggactttacaccacaaaatcatcatgcccaaaaatgcatttaaacacaatgttttcttaagtctgcactgctgtaaattgtgaatcagaatgtttatttataggtgcctagattagtagggctttttgacccacaacttgactaaaatgtcattgacttggcagcactttatggcatcgggtaaagaaattcttaagacattaaaagctgctttttgcatttaaagactatgattaattggtacatacattaaaataaactttgatttttttttggtattactggtcccttaaccccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MASAPVWALLALCCVMQPGSSLVRIPLKKFTSIRRAMSETDQDALKLSGNEAATKYSAFLNSKNPTPETLLNYLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKYDSSKSTTYINNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGILGMGYPKISVDGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNVTRKAYWQIHMDQLSVGDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLICGEYMILCDSIPSLPVISFTFGGRAYSLTGEQYVLKISKAGRTVCLSGFLGLDIPPPAGPLWIIGDVFIGQYYTVFDRANDRVGFAKAK
Donor tissue: gastrula