ORFeome > cycs – XORFeome 2.0

cycs – XORFeome 2.0

General Information

Species: Xenopus tropicalis cytochrome c, somatic, mRNA (cDNA clone MGC:75709 IMAGE:5380711), complete cds
Gene Symbol: cycs
Gene ID: 394490
ORF gb_acc: MG132959
ORF ID: 10335

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059740

Library Location

Plate ID: GDExt11003
Well Location: E08

EST Sequences

Clone: MGC:75709 IMAGE:5380711
Trimmed Sequence: ATGGGAGACGCTGAAAAAGGCAAGAAAATCTTTGTTCAGAAATGTTCCCAGTGCCACACTGTAGAGAAAGGAGGCAAGCACAAAACTGGGCCTAACCTTCACGGCCTGTTTGGACGCAAGACTGGACAAGCAGAAGGCTTTTCCTATACTGATGCTAACAAAAATAAGGGAATTGTTTGGGATGAGGGTACCCTTCTGGAATATCTAGAAAATCCTAAGAAGTACATTCCTGGAACAAAGATGATCTTTGCTGGCATTAAGAAGAAGGGCGAGAGACAAGACTTAATAGCATATCTAAAACAGTCAACCAGCAGTTAA
Full Trace Sequence: cgctgattggatagcaggctgataatgtagtattgtcgtcataagccggtcgtagggtttggttgcaaaaacaccggttacaaaggagtgggcgcagcgtgtccttgggagtagaacgtcggagaccgaaggggcaggagttctcagtagcacatacagagcaaggtgcaaacatgggagacgctgaaaaaggcaagaaaatctttgttcagaaatgttcccagtgccacactgtagagaaaggaggcaagcacaaaactgggcctaaccttcacggcctgtttggacgcaagactggacaagcagaaggcttttcctatactgatgctaacaaaaataagggaattgtttgggatgagggtacccttctggaatatctagaaaatcctaagaagtacattcctggaacaaagatgatctttgctggcattaagaagaagggcgagagacaagacttaatagcatatctaaaacagtcaaccagcagttaataaccatatgtcctgccttatttatttcagggattgtttgtgatgagatactgtaaaattttatatatatttttatttgtactgtccatacatcttttagagggtgtctcatcagccagagaatgtaaatcttaagggagatcattgaaatgaatttggctatgtctccagtgttttttgaagtcaaaaatgcttattgatctaaacatctaataaaactgtccatgttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVWDEGTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
Donor tissue: tadpole