ORFeome > dazap1 – XORFeome 2.0

dazap1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis DAZ associated protein 1, mRNA (cDNA clone MGC:89358 IMAGE:6988091), complete cds
Gene Symbol: dazap1
Gene ID: 448406
ORF gb_acc: MG133882
ORF ID: 11467

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075497

Library Location

Plate ID: GDExt11014
Well Location: B09

EST Sequences

Clone: MGC:89358 IMAGE:6988091
Trimmed Sequence: ATGAACAACCAAGGCGGGGACGAGATTGGAAAGCTCTTTGTTGGTGGCCTTGACTGGAGCACGACGCAGGAAACCCTGCGCAGCTATTTTTCTCAGTATGGAGAAGTCGTAGACTGTGTAATAATGAAAGACAAAACAACAAATCAGTCAAGAGGCTTTGGCTTTGTCAAATTTAAGGATCCCAATTGTGTAGGAACCGTCCTAGCCAGCAGACCGCACACATTGGATGGCAGGAATATTGATCCAAAGCCATGTACCCCTCGAGGAATGCAGCCTGAGAGAACCCGGCCACGAGAAGGCTGGCAGCAAAAAGGACCCAGAACTGAAAACAGTAGGTCCAACAAAATTTTTGTGGGAGGAATTCCACACAACTGTGGGGAAACTGAACTGAGGGAATATTTTAAAAGATTTGGAGTGGTAACTGAAGTGGTTATGATTTATGATGCTGAAAAACAGAGGCCAAGAGGTTTTGGATTTATAACTTTCGAGGACGAACAATCAGTGGACCAGGCTGTCAACATGCATTTTCACGACATCATGGGCAAAAAAGTTGAAGTCAAACGGGCAGAACCACGTGATAGCAAAAGCCAAACTCCAGGACCTCCTGGATCAAACCAGTGGGGAGGTAGAGCAATGCAAAGCACAGCTAATGGATGGACAGGACAGCCTCCTCCAACGTGGCAGCAGAGCTACAGTCCACAAGGTATGTGGATGCCAACAGGACAGACCATTGGCGGGTACGGTCCACCTGCAGGCCGGGGGGGTCCTCCACCACCACCTTCCTTTGCACCATTCCTAGTGTCAACAACCCCTGGAGCTTTCCCACCACCACAGGGCTTTCCTCCTGGATATGCCACACCACCTCCATTCGGCTATGGCTATGGGCCACCCCCTCCCCCTCCTGATCAGTTCGTCTCTTCAGGAGTTCCACCACCTCCTGGAACTCCAGGGGCAGCACCGTTAGCGTTCCCTCCACCTCCCCCAGGGCAGTCAGCTCAAGATCTGAGCAAACCCCCCAGTGGTCAGCAGGATTTTCCTTTTAGCCAGTTTGGAAATGCCTGCTTTGTGAAATTGTCCGAGTGGATTTGA
Full Trace Sequence: gttaccgttggccgggttggtaggagaagctgcagagaccggagaggggcgacggagatatgaacaaccaaggcggggacgagattggaaagctctttgttggtggccttgactggagcacgacgcaggaaaccctgcgcagctatttttctcagtatggagaagtcgtagactgtgtaataatgaaagacaaaacaacaaatcagtcaagaggctttggctttgtcaaatttaaggatcccaattgtgtaggaaccgtcctagccagcagaccgcacacattggatggcaggaatattgatccaaagccatgtacccctcgaggaatgcagcctgagagaacccggccacgagaaggctggcagcaaaaaggacccagaactgaaaacagtaggtccaacaaaatttttgtgggaggaattccacacaactgtggggaaactgaactgagggaatattttaaaagatttggagtggtaactgaagtggttatgatttatgatgctgaaaaacagaggccaagaggttttggatttataactttcgaggacgaacaatcagtggaccaggctgtcaacatgcattttcacgacatcatgggcaaaaaagttgaagtcaaacgggcagaaccacgtgatagcaaaagccaaactccaggacctcctggatcaaaccagtggggaggtagagcaatgcaaagcacagctaatggatggacaggacagcctcctccaacgtggcagcagagctacagtccacaaggtatgtggatgccaacaggacagaccattggcgggtacggtccacctgcaggccgggggggtcctccaccaccaccttcctttgcaccattcctagtgtcaacaacccctggagctttcccaccaccacagggctttcctcctggatatgccacaccacctccattcggctatggctatgggccaccccctccccctcctgatcagttcgtctcttcaggagttccaccacctcctggaactccaggggcagcaccgttagcgttccctccacctcccccagggcagtcagctcaagatctgagcaaaccccccagtggtcagcaggattttccttttagccagtttggaaatgcctgctttgtgaaattgtccgagtggatttgacctctctaagaagtccatcaaaggttatggacaagacatgagtgggtatgggcaaagtttccctgacctcaaccagcaacccccttatacgtcaggaccctccacaccagcatcgggaggcccacccgccgggggaagtggtttgggcagagggcagaatcacaatgtgcaaggattccatccctacaggcgctaatatcaggcaggcagaattgtgcacagtgacgatgagctgacacttccacctctgaacttgtgacaatcacgtggtgaagaccattcctgctatagacttgtggaagttctaagtttgaaggagaagctgtgggtatttggactacagttttcagatctttttctgacccatcagcacaaataaagccaatgagtcactggttccaaaaaaataaaaaaaaaaaaaaaaaaaaa
Translation: MNNQGGDEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPREGWQQKGPRTENSRSNKIFVGGIPHNCGETELREYFKRFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQTPGPPGSNQWGGRAMQSTANGWTGQPPPTWQQSYSPQGMWMPTGQTIGGYGPPAGRGGPPPPPSFAPFLVSTTPGAFPPPQGFPPGYATPPPFGYGYGPPPPPPDQFVSSGVPPPPGTPGAAPLAFPPPPPGQSAQDLSKPPSGQQDFPFSQFGNACFVKLSEWI
Donor tissue: gastrula