ORFeome > dbi – XORFeome 2.0

dbi – XORFeome 2.0

General Information

Species: Xenopus tropicalis diazepam binding inhibitor (dbi), mRNA (cDNA clone MGC:75740 IMAGE:5381377), complete cds
Gene Symbol: dbi
Gene ID: 394469
ORF gb_acc: MG132950
ORF ID: 10324

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059746

Library Location

Plate ID: GDExt11003
Well Location: D09

EST Sequences

Clone: MGC:75740 IMAGE:5381377
Trimmed Sequence: ATGTCTCAGGAAGCGTTTGACAAGGCGGCAGAGGAGGTGAAGCAGCTGAAATCCACCCCCACAGATGAGGAAATGCTGGAGACCTACGCACTGTACAAACAGGCCACCGTAGGGGATGTAGATACAGCCCGACCTGGAATGTTGGACTTCAAAGGCAAAGCCAAGTGGGATTCCTGGAAGAAGAAGGAAGGAACCAGCAAGGAGGATGCCAGGGCCCAGTATGTGGATTGGGTTGAAAAGCTAAAGGCCAAATACGGATCGTAA
Full Trace Sequence: accggcggcgcagaaagtgaggaaggtcgaagcggaaccgaagcagcagaatgtctcaggaagcgtttgacaaggcggcagaggaggtgaagcagctgaaatccacccccacagatgaggaaatgctggagacctacgcactgtacaaacaggccaccgtaggggatgtagatacagcccgacctggaatgttggacttcaaaggcaaagccaagtgggattcctggaagaagaaggaaggaaccagcaaggaggatgccagggcccagtatgtggattgggttgaaaagctaaaggccaaatacggatcgtaacgtgtctccgcccctaaggggcaaatacggatcgtaacgtgtctccgcccctaaggggcaaatacggatgttgccctgtctcggtgccctttgcgctgaataacggttccttttgtacttttcatacaccagctgtacagtaacaataaagtctctgtccctttcaaaaaaaaaaaaaaa
Translation: MSQEAFDKAAEEVKQLKSTPTDEEMLETYALYKQATVGDVDTARPGMLDFKGKAKWDSWKKKEGTSKEDARAQYVDWVEKLKAKYGS
Donor tissue: tadpole