ORFeome > ddit4 – XORFeome 2.0

ddit4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis DNA-damage-inducible transcript 4, mRNA (cDNA clone MGC:76013 IMAGE:5384655), complete cds
Gene Symbol: ddit4
Gene ID: 394782
ORF gb_acc: MG133478
ORF ID: 11001

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063371

Library Location

Plate ID: GDExt11010
Well Location: D01

EST Sequences

Clone: MGC:76013 IMAGE:5384655
Trimmed Sequence: ATGCCTGCAAGGTGGGATACCTTCTCTGCTCTCTCTGTCCCACCCCCCATCTTGGAGGAAGAGCCCCAATCCCAGTTTTGGGGTGAGGACTGCGCAGATGTGTCGCAAAGGTGCTCCAGTTTGCCCAGTTCCGACTGCGAATCTCTCACCAGTAGCAACTCTTATTCTGAATGTGATCTAGATGCTTGGGATGAAATCTCATTACCAGACTCAGAGCTTCTGAATGATCCTGAAGGAGAGCAGCTCTGCCCCAGTCTTCTAAAGCTTATAAAACGATGCCTGACCAAAGCTAAAATCAACTCCCTGAGGTGTTCTAGGCTTCTTATTCCTGATGAACTCTTGTGTAATCTGGGTCAAGAACTTCTACACTTGGCGTACAGTGAACCATGTGGACTTAGGGGAGCACTTATTGACTTGTGTGTTGAGCATGGCAAGGACTGCCACAGTGTGGCCCAGATCACTGTTGATCAAGCTGTTGTACCTACTTTCCAGCTTACTGTGCTGCTGAGACTGGACTCCAGGCTGTGGCCTAGAATACAGGGCCTCTTTAGCACCAAGCCAGTTCCGGGTTCTGGACAATCTTTGAAACTTAGCCCTGGATTCAAGGTTCTTAAAAAGAAACTGTATAGTTCTGAAGAACTTATTATAGAGGAATGCTGA
Full Trace Sequence: cacttgcatatgttgtgcttagcagcagagctgaagagcaaaggagtgcttggggctgctaacgcactgaaactgcacttaattgaccgataaaatttggaatctgacttctataacttgtgatttccctcgaaccagttatttgcacttgattactagttgctctgcactcactccttagagaagaccagacatgcctgcaaggtgggataccttctctgctctctctgtcccaccccccatcttggaggaagagccccaatcccagttttggggtgaggactgcgcagatgtgtcgcaaaggtgctccagtttgcccagttccgactgcgaatctctcaccagtagcaactcttattctgaatgtgatctagatgcttgggatgaaatctcattaccagactcagagcttctgaatgatcctgaaggagagcagctctgccccagtcttctaaagcttataaaacgatgcctgaccaaagctaaaatcaactccctgaggtgttctaggcttcttattcctgatgaactcttgtgtaatctgggtcaagaacttctacacttggcgtacagtgaaccatgtggacttaggggagcacttattgacttgtgtgttgagcatggcaaggactgccacagtgtggcccagatcactgttgatcaagctgttgtacctactttccagcttactgtgctgctgagactggactccaggctgtggcctagaatacagggcctctttagcaccaagccagttccgggttctggacaatctttgaaacttagccctggattcaaggttcttaaaaagaaactgtatagttctgaagaacttattatagaggaatgctgatatttcagtggcagaagtgtggggggcgctagtgttacttggtactgcaatcatgaaggcttaaaagtattttaaaagtttactaaaatgttttatgttaaaatatttttttttttttttacaaaaaaaaaaatgcttttagatggtgttaggacactgtctgtctctggttaaccccttcactacagagtaaagagcgatgccttgttaaatgctcattgccacagtagtgaaatggttctgatccatttgggagatggcgggattttaaaggaatacatttcactctgctttttgaagaataaattttgtagtgaatttatgcacgtaaatcattgataactgtataaagtgcactggtggcttttttttttttttttccttctgtactgtatcagcagctggtctgcactaaagggtgaatatgcccgacctcttgaagagggtaaagtttttttgcaaaaccaaaaagtataatttccctctggggaccaagtgttatattgttcacatcgcctgactactgatgctatggcagctatgttatgtggtgttataaatttttttttttttcttcagattcaggcagcagaatgttctaaagcactacccttttattaaaaaaaaatgtgtcctatgtactctaatatgctgctttattatggtttacagtgatacacttgatgttcaagtaaaactacacacaatgtgccttttttacttttctattaaaaacaatgaaatgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPARWDTFSALSVPPPILEEEPQSQFWGEDCADVSQRCSSLPSSDCESLTSSNSYSECDLDAWDEISLPDSELLNDPEGEQLCPSLLKLIKRCLTKAKINSLRCSRLLIPDELLCNLGQELLHLAYSEPCGLRGALIDLCVEHGKDCHSVAQITVDQAVVPTFQLTVLLRLDSRLWPRIQGLFSTKPVPGSGQSLKLSPGFKVLKKKLYSSEELIIEEC
Donor tissue: neurula