ORFeome > denr – XORFeome 2.0

denr – XORFeome 2.0

General Information

Species: Xenopus tropicalis density-regulated protein, mRNA (cDNA clone MGC:79758 IMAGE:6984487), complete cds
Gene Symbol: denr
Gene ID: 448530
ORF gb_acc: MG133713
ORF ID: 11273

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076697

Library Location

Plate ID: GDExt11012
Well Location: H07

EST Sequences

Clone: MGC:79758 IMAGE:6984487
Trimmed Sequence: ATGGCCAGTATAGCTATTGAGAATGCAGAGCCAGTACCATCAGACTGCAAAGGAGATTTAAAAATCTCCAAATTTGATGGAGATTTACCACTTAAAGTTCTTTACTGCGGAGTGTGTTCTCTGCCAACAGAGTATTGTGAGTACATGCCTGATGTTGCAAAGTGTAGACAATGGCTTGAAAAGAATTTTCCAGACGAATTTTCAAAGCTTACATTAGGAATTTCTCCAAAACAAGAAACTGGTACTGTTGAAGGCCAAGCAACTTCTGGTGAAGAAGAAGAGAAAAAGAAGCAAAAAAGAGGTGGCCGAGGTCAAATTAAACAGAAGAAAAAGACTGTACCTCAAAAGGTTACAATAGCAAAAATTCCGAGAGCCAAAAAGAAATATGTCACAAGGGTCTGCGGCCTTGCCACATTTGAAATTGAACTTAAGGATGCACAAAGATTTTTTGCCCAGAAATTTTCCTGCGGAGCTTCAGTAACAGGGGAAGATGAAATCATCATTCAGGGGGACTTTACAGATGATATTATTGATGTAATTCAAGAAAAATGGCCAGAGGTTGATGATGACAGCATTGAAGATCTGGGTGAAGTGAAAAAATGA
Full Trace Sequence: gcattactgaggtctaacagatggccagtatagctattgagaatgcagagccagtaccatcagactgcaaaggagatttaaaaatctccaaatttgatggagatttaccacttaaagttctttactgcggagtgtgttctctgccaacagagtattgtgagtacatgcctgatgttgcaaagtgtagacaatggcttgaaaagaattttccagacgaattttcaaagcttacattaggaatttctccaaaacaagaaactggtactgttgaaggccaagcaacttctggtgaagaagaagagaaaaagaagcaaaaaagaggtggccgaggtcaaattaaacagaagaaaaagactgtacctcaaaaggttacaatagcaaaaattccgagagccaaaaagaaatatgtcacaagggtctgcggccttgccacatttgaaattgaacttaaggatgcacaaagattttttgcccagaaattttcctgcggagcttcagtaacaggggaagatgaaatcatcattcagggggactttacagatgatattattgatgtaattcaagaaaaatggccagaggttgatgatgacagcattgaagatctgggtgaagtgaaaaaatgaatttgacattgtgcctgtatatcacaacccaatgtaacagtcattgcagccaaagcaaggaggaacttttgtgttcaattcagtcagacagtgcagccttatcctttgcacctgcagatctctatagattgccatttgtttttatttccaactgctcaactggatataacattttctcctgcattacctgtttagaataataaaataattttgatcattcaaaaaaaaaaaaaaaaaaaaa
Translation: MASIAIENAEPVPSDCKGDLKISKFDGDLPLKVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPDEFSKLTLGISPKQETGTVEGQATSGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIELKDAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Donor tissue: tadpole