ORFeome > df – XORFeome 2.0

df – XORFeome 2.0

General Information

Species: Xenopus tropicalis D component of complement (adipsin), mRNA (cDNA clone MGC:76105 IMAGE:5308471), complete cds
Gene Symbol: df
Gene ID: 394945
ORF gb_acc: MG132711
ORF ID: 10003

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064208

Library Location

Plate ID: GDExt11001
Well Location: G06

EST Sequences

Clone: MGC:76105 IMAGE:5308471
Trimmed Sequence: ATGAATGTCTCCTGGGCTCTATTAGCGGTGGTCCTGGTACTAACTGTTGCCACCTATGAGTGTCGGCCACGTGGACGTATTCTAGGTGGGCAGGATTCAAAGGCAGAAGTCAGGCCTTATATGGCATCTATTCAGCAGAATGGGATCCACCAATGTGGGGGGGTCCTTATTGCTGATAAATGGGTGCTGAGCGCAGCACACTGTGCCACTAACAGCTCTAATTCGTCTCTGAATGTGATGCTCGGTGCTATATCTCTCTCCAAACCAGAGAAATACAAAATAGTTGTAAAGGTGCTCAGGGAGATCCCTCACCCACTATACAATTCTACAATAAAGCATCATGACCTTCTCTTGCTAGAGCTATCTGAAAAAGTAACACTAAGCCCAGCTGTGAACCCGCTACCCTTCCAAAACGAAAATATTGACATCTCTGCAGGGAAACGATGCCTAGTCGCAGGCTGGGGACAGATGAGACTGACTGGAAAGAAGCCAGACACTTTGCAAGAATTATGGGTACCCCTGATTAGCAGGGATGTCTGTAATCGCCGGAACTACTATGACAATGAAATCACCGCAAATATGATATGTGCAGGAGAGAGCAGGAAGGACTCATGTGAGGGAGACTCCGGGGGACCTCTAGTATGTGATGGAATAGCAGTGGCTATTGTACAGGGTGGATTTCGGAAATGTGGCAATCCAACGAAACCAGGCATCTACACTCTCATTGAGCCTTACAAATCCTGGATAATGGAAAGCATGTATAATGCTACACTACAGAGTAACCCATCCCCTTTGTGA
Full Trace Sequence: gccaaacatgaatgtctcctgggctctattagcggtggtcctggtactaactgttgccacctatgagtgtcggccacgtggacgtattctaggtgggcaggattcaaaggcagaagtcaggccttatatggcatctattcagcagaatgggatccaccaatgtgggggggtccttattgctgataaatgggtgctgagcgcagcacactgtgccactaacagctctaattcgtctctgaatgtgatgctcggtgctatatctctctccaaaccagagaaatacaaaatagttgtaaaggtgctcagggagatccctcacccactatacaattctacaataaagcatcatgaccttctcttgctagagctatctgaaaaagtaacactaagcccagctgtgaacccgctacccttccaaaacgaaaatattgacatctctgcagggaaacgatgcctagtcgcaggctggggacagatgagactgactggaaagaagccagacactttgcaagaattatgggtacccctgattagcagggatgtctgtaatcgccggaactactatgacaatgaaatcaccgcaaatatgatatgtgcaggagagagcaggaaggactcatgtgagggagactccgggggacctctagtatgtgatggaatagcagtggctattgtacagggtggatttcggaaatgtggcaatccaacgaaaccaggcatctacactctcattgagccttacaaatcctggataatggaaagcatgtataatgctacactacagagtaacccatcccctttgtgaaaccataaggggtaatcctgttgcaacaaggttattctacaataaatgaaacactcagatatctgctttttaacttttgatgcttctagtagtttactcaataaaggtttggttctttggttctgagaacaaagtgtaatgaatggcacaataaaatccttttgcaaaaaaaaaaaactaacaggttctaaaaaagttatacttttgtactaaagaagtgtaatggaatatttaggactcttacatctcacaaagcagcaattcagtaatgtgttattgctgctctttgaacatttagaacacagtggtttgatttgttaatattaagattctgaatcttttgattaaggacaaaagcagaaggggctatgggaattgccttagtgataggggtgcttttgaggattttgttcaccacatattgagctattgagcaacaaaacagtcaacattttccgtgtatcattgccctaacagtgacatttagtgaaatttatatagagatggtctagcaatgatacaggaactcctgggcaattttataatacgggatataatgtacaccctactgtatattaaaaggatattaaatgagaactaaaacctcaattgtacaaccatatcaatggcccccagacaccccaaaccacaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNVSWALLAVVLVLTVATYECRPRGRILGGQDSKAEVRPYMASIQQNGIHQCGGVLIADKWVLSAAHCATNSSNSSLNVMLGAISLSKPEKYKIVVKVLREIPHPLYNSTIKHHDLLLLELSEKVTLSPAVNPLPFQNENIDISAGKRCLVAGWGQMRLTGKKPDTLQELWVPLISRDVCNRRNYYDNEITANMICAGESRKDSCEGDSGGPLVCDGIAVAIVQGGFRKCGNPTKPGIYTLIEPYKSWIMESMYNATLQSNPSPL
Donor tissue: gastrula