ORFeome > dnaja1 – XORFeome 2.0

dnaja1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis DnaJ (Hsp40) homolog, subfamily A, member 1, mRNA (cDNA clone MGC:89271 IMAGE:6976951), complete cds
Gene Symbol: dnaja1
Gene ID: 496421
ORF gb_acc: MG133816
ORF ID: 11390

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082725

Library Location

Plate ID: GDExt11013
Well Location: G04

EST Sequences

Clone: MGC:89271 IMAGE:6976951
Trimmed Sequence: ATGGTGGTAGAAACTGCATACTATGATATATTGGGAGTTAAGCCAAATTCCACTCCGGATGAGCTGAAAAAGGCTTATAGGAAACTTGCCCTCAAGTATCACCCAGACAAGAATCCCAATGAAGGTGAAAAGTTCAAACAGATTTCCCAGGCTTATGAAGTGCTCTCTGATTCCAAGAAAAGAGACTTGTATGATAAAGGCGGTGAACAGGCAATTAAAGAGGGAGGCATGGGAGGTGGCGGTTTTGCATCACCAATGGATATCTTTGACATGTTTTTTGGTGGCGGTGGAAGAATGCAACGAGAGAGAAGAGGTAAAAACGTAGTTCATCAGTTATCTGTATCCCTTGAAGATTTGTATAATGGTGCCACAAGAAAACTTGCTGTGCAGAAGAATACTATCTGTGATAAGTGTGAAGGTCGTGGAGGTAAAAAAGGGGCTGTAGAATGCTGTCCAAATTGTAGGGGCACTGGCATGCAGATTAGAATCCACCAGTTAGGACCTGGAATGGTTCAGCAGATACAGTCAGTATGCCCAGAGTGTCAAGGACAAGGAGAGAGGATCAATCCAAAGGACCGGTGTAAGAGCTGCAATGGGCGAAAGATAGTCCGAGAGAAGAAGATTCTTGAAGTTCATATTGACAAGGGAATGAAAGATGGTCAGAAGATCACATTCTCTGGTGAAGGGGACCAGGAACCGGGACTGGAGGCTGGAGATATTATCATTGTATTGGACCAAAAAGATCATTCTGTTTTCACACGGAGAAATGAAGACCTAATTATACACATGGAAATAGAGCTTGTGGAGGCATTATGTGGCTTTCAAAAACCTATTGTTACATTGGATTCAAGGACCATAATTATTACTTCTCATCCTGGCCAGATTGTTAAACATGGAGATGTAAAATGTGTGTTGAATGAAGGCATGCCAATCTACCGCAGACCATATGACAAAGGACGTCTCATTGTTCAATTCCAGGTTAACTTTCCAGCCAGTAACTCCATTTCACCAGACAAGCTTCCTTTGCTGGAAAAGCTCTTGCCTGCAAGGAAAGAGATAGAAGAGACAGAAGACATGGAGCAGGCTGAACTAATGGATTTTGATCCATCTCAACAAAGGCGTAGGCATTTTAATGGTGAAGCATACCATGATGATGATGACGATGACCACCCAAGAAGTGGTGTTCAGTGCCAGACTTCTTAA
Full Trace Sequence: cccggatgtgactcttgttccctcgatccttctagaagctgttagacggagaagaccgctagccaccttgaatatacagtgcattatcgtgggtttaaggaaatctgccactaccagccacactgaaaatggtggtagaaactgcatactatgatatattgggagttaagccaaattccactccggatgagctgaaaaaggcttataggaaacttgccctcaagtatcacccagacaagaatcccaatgaaggtgaaaagttcaaacagatttcccaggcttatgaagtgctctctgattccaagaaaagagacttgtatgataaaggcggtgaacaggcaattaaagagggaggcatgggaggtggcggttttgcatcaccaatggatatctttgacatgttttttggtggcggtggaagaatgcaacgagagagaagaggtaaaaacgtagttcatcagttatctgtatcccttgaagatttgtataatggtgccacaagaaaacttgctgtgcagaagaatactatctgtgataagtgtgaaggtcgtggaggtaaaaaaggggctgtagaatgctgtccaaattgtaggggcactggcatgcagattagaatccaccagttaggacctggaatggttcagcagatacagtcagtatgcccagagtgtcaaggacaaggagagaggatcaatccaaaggaccggtgtaagagctgcaatgggcgaaagatagtccgagagaagaagattcttgaagttcatattgacaagggaatgaaagatggtcagaagatcacattctctggtgaaggggaccaggaaccgggactggaggctggagatattatcattgtattggaccaaaaagatcattctgttttcacacggagaaatgaagacctaattatacacatggaaatagagcttgtggaggcattatgtggctttcaaaaacctattgttacattggattcaaggaccataattattacttctcatcctggccagattgttaaacatggagatgtaaaatgtgtgttgaatgaaggcatgccaatctaccgcagaccatatgacaaaggacgtctcattgttcaattccaggttaactttccagccagtaactccatttcaccagacaagcttcctttgctggaaaagctcttgcctgcaaggaaagagatagaagagacagaagacatggagcaggctgaactaatggattttgatccatctcaacaaaggcgtaggcattttaatggtgaagcataccatgatgatgatgacgatgaccacccaagaagtggtgttcagtgccagacttcttaaatgaagcaaccgaatcatgcattcagattttttttttttttttttttttaaccgtgctctaaagctgtaagaaggtgatggaatccagcagttagttctgctctaagggtgcctagaactaaatccaccattttctggagtaatatattaggcttttgaacacaaccaaatgaagcatctcttgtatgaaatctgttaggaggactgtctggtgcacatgctacatgttttaaaatcactgtttgaagaattgtgacaaattaaactctgtagtgcaactgtgaaaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVVETAYYDILGVKPNSTPDELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDSKKRDLYDKGGEQAIKEGGMGGGGFASPMDIFDMFFGGGGRMQRERRGKNVVHQLSVSLEDLYNGATRKLAVQKNTICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQLGPGMVQQIQSVCPECQGQGERINPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFSGEGDQEPGLEAGDIIIVLDQKDHSVFTRRNEDLIIHMEIELVEALCGFQKPIVTLDSRTIIITSHPGQIVKHGDVKCVLNEGMPIYRRPYDKGRLIVQFQVNFPASNSISPDKLPLLEKLLPARKEIEETEDMEQAELMDFDPSQQRRRHFNGEAYHDDDDDDHPRSGVQCQTS
Donor tissue: tailbud