ORFeome > dnase1l3 – XORFeome 2.0

dnase1l3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis deoxyribonuclease 1-like 3, mRNA (cDNA clone MGC:76250 IMAGE:5379009), complete cds
Gene Symbol: dnase1l3
Gene ID: 394515
ORF gb_acc: MG132768
ORF ID: 10076

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061621

Library Location

Plate ID: GDExt11002
Well Location: C04

EST Sequences

Clone: MGC:76250 IMAGE:5379009
Trimmed Sequence: ATGTGGCGCCTCCTTCTCTTCTGGGCGCTTTTTGTCCCCCACACTCTGGGGCTTCAAATCTGCTCCTTTAATGTCCAGTCGTTTGGGGAGTCCAAACGGGACAAACCTGCTGTCATGAATATAGTGAGAAAGGTCATTTCCCGCTGTGACATCACGCTCCTGATGGAGATCAAGGACAGCAGCGACACCGTAATCCGATCGCTAATGACACAACTCAACAGCCAATCAGAAACAAGAAATCAGTTTGATTTAACCATCAGCCAAAGGCTGGGCCGCAAGAGCTACAAGGAACAATATGGCTTCATCTATAGGAAAAAGTTGGTGTCAGTGAGAGGAACGTACCAATATGAAGACTCCCAGCCGGGGGATCCGGATGCTTTCTCTCGGGAGCCCTATGTGGTGTGGTTTGAAGCGCCCAGCACTGACGTCAGAGAGTTTGTGATCGTGCCCCAGCACACCACCCCCGAGGCCGCAGTCCGGGAAATCGATGAACTTTACGACGTTTACCTCGATGTCAAACAGAAATGGAACTCGGAGAACTTCATTTTCATGGGGGACCTAAACGCCGGCTGCGCCTACGTGCCCAAGAAAGCCTGGGGGAACATCCGGCTCCGGACCCACTCGGAGTTTGTTTGGCTGATTGGGGACAAGGAGGACACGACGGTGAAGGCCAGCACCAAATGCGCCTACGACAGGATTGTGATGGCCGGAGACAAGCTGCTCAGCTCCGTGGTACCAGGTTCTGCCCAAGTGTTTGACTTCATGGCTGTGTATGGGCTGACGGAAGATCAGGCCCTGGAGGTGAGCGACCACTTCCCCGTCGAGGTGCAGCTGAAGGAATCCAAGCGGCCGACTTCCAGGAGGCGGAAACACATCGAGAGGAAATAA
Full Trace Sequence: caaggtgtctgtgtccccaagagctgacaatcatgtggcgcctccttctcttctgggcgctttttgtcccccacactctggggcttcaaatctgctcctttaatgtccagtcgtttggggagtccaaacgggacaaacctgctgtcatgaatatagtgagaaaggtcatttcccgctgtgacatcacgctcctgatggagatcaaggacagcagcgacaccgtaatccgatcgctaatgacacaactcaacagccaatcagaaacaagaaatcagtttgatttaaccatcagccaaaggctgggccgcaagagctacaaggaacaatatggcttcatctataggaaaaagttggtgtcagtgagaggaacgtaccaatatgaagactcccagccgggggatccggatgctttctctcgggagccctatgtggtgtggtttgaagcgcccagcactgacgtcagagagtttgtgatcgtgccccagcacaccacccccgaggccgcagtccgggaaatcgatgaactttacgacgtttacctcgatgtcaaacagaaatggaactcggagaacttcattttcatgggggacctaaacgccggctgcgcctacgtgcccaagaaagcctgggggaacatccggctccggacccactcggagtttgtttggctgattggggacaaggaggacacgacggtgaaggccagcaccaaatgcgcctacgacaggattgtgatggccggagacaagctgctcagctccgtggtaccaggttctgcccaagtgtttgacttcatggctgtgtatgggctgacggaagatcaggccctggaggtgagcgaccacttccccgtcgaggtgcagctgaaggaatccaagcggccgacttccaggaggcggaaacacatcgagaggaaataaggtcccccatgtcggccattactgtgctaacaaggaccagtctgttgcctcttatctttatatctaacaaatgtggggtgtggggacgtggggaagggatccagagctacagaagtgtttcttcatcagaaccttccattttggggtcccacattgtactgtggtctcttctctgcacattgatccgcgtggcaaaatatctggggtgcagggtaaattcagtttattagggctcactatggggaccagagctgggcattcatttgctagaataggcccccctacagtggcggttgtcaagtccattctctggtcagggcccccctgagctctcaatataagtcaaagttgcaagaatatgaaggaaaacataaatacgtacaccccaaatctcacaggtctgcaggctggaattctgggagtattgaggagagaaaatggccattcagttgtgacctaatctgccccccggccccattactaatcagacgggggcgcatccatccagatgtggggtccgggggtacagaggggccagaaccagttattctgggagtttaaggggaaatattatcataaacaggttttctgcttcccaataaaaatgtattttgttgttgaataaatgattgtggatgaaaggttaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MWRLLLFWALFVPHTLGLQICSFNVQSFGESKRDKPAVMNIVRKVISRCDITLLMEIKDSSDTVIRSLMTQLNSQSETRNQFDLTISQRLGRKSYKEQYGFIYRKKLVSVRGTYQYEDSQPGDPDAFSREPYVVWFEAPSTDVREFVIVPQHTTPEAAVREIDELYDVYLDVKQKWNSENFIFMGDLNAGCAYVPKKAWGNIRLRTHSEFVWLIGDKEDTTVKASTKCAYDRIVMAGDKLLSSVVPGSAQVFDFMAVYGLTEDQALEVSDHFPVEVQLKESKRPTSRRRKHIERK
Donor tissue: tailbud