ORFeome > dnase1l3 – XORFeome 2.0

dnase1l3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis deoxyribonuclease 1-like 3, mRNA (cDNA clone MGC:89816 IMAGE:7028417), complete cds
Gene Symbol: dnase1l3
Gene ID: 394515
ORF gb_acc: MG133155
ORF ID: 10599

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080151

Library Location

Plate ID: GDExt11005
Well Location: A12

EST Sequences

Clone: MGC:89816 IMAGE:7028417
Trimmed Sequence: ATGTGGCGCCTCCTTCTCTTCTGGGCGCTTTTTGTCCCCCACACTCTGGGGCTTCAAATCTGCTCCTTTAATGTCCAGTCGTTTGGGGAGTCCAAACGGGACAAACCTGCTGTCATGAATATAGTGAGAAAGGTCATTTCCCGCTGTGACATCATGCTCCTGATGGAGATCAAGGACAGCAGCGACACCGTAATCCGATCGCTAATGACACAACTCAACAGCCAATCAGAAACAAGAAATCAGTTTGATTTAACCATCAGCCAAAGGCTGGGCCGCAAGAGCTACAAGGAACAATATGGCTTCATCTATAGGAAGAAGATGGTGTCAGTGAGAGGAACGTACCAATATGAAGACTCCCAGCCGGGGGATCCGGATGCTTTCTCTCGGGAGCCCTATGTGGTGTGGTTTGAAGCGCCCAGCACTGACGTCAGAGAGTTTGTGATCGTGCCCCAGCACACCACCCCCGAGGCCGCAGTCCGGGAAATCGATGAACTTTACGACGTTTACCTCGATGTCAAACAGAAATGGAACTCGGAGAACTTCATTTTCATGGGGGACCTAAACGCCGGCTGCGCCTACGTGCCCAAGAAAGCCTGGGGGAACATCCGGCTCCGGACCCACTCGGAGTTTGTTTGGCTGATTGGGGACAAAGAGGACACGACGGTGAAGGCCAGCACCAAGTGCGCCTACGACAGGATTGTGATGGCCGGAGACAAGCTGCTCAGCTCCGTGGTACCAGGTTCTGCCCAAGTGTTTGACTTCATGGCTGTGTATGGGCTGACGGAAGATCAGGCCCTGGAGGTGAGCGACCACTTCCCCGTCGAGGTGCAGCTGAAGGAATCCAAGCGGCCGACTTCCAGGAGGCGGAAACACATCGAGAGGAAATAA
Full Trace Sequence: gaggagaggcacaaggtgtctgtgtccccaagagctgacaatcatgtggcgcctccttctcttctgggcgctttttgtcccccacactctggggcttcaaatctgctcctttaatgtccagtcgtttggggagtccaaacgggacaaacctgctgtcatgaatatagtgagaaaggtcatttcccgctgtgacatcatgctcctgatggagatcaaggacagcagcgacaccgtaatccgatcgctaatgacacaactcaacagccaatcagaaacaagaaatcagtttgatttaaccatcagccaaaggctgggccgcaagagctacaaggaacaatatggcttcatctataggaagaagatggtgtcagtgagaggaacgtaccaatatgaagactcccagccgggggatccggatgctttctctcgggagccctatgtggtgtggtttgaagcgcccagcactgacgtcagagagtttgtgatcgtgccccagcacaccacccccgaggccgcagtccgggaaatcgatgaactttacgacgtttacctcgatgtcaaacagaaatggaactcggagaacttcattttcatgggggacctaaacgccggctgcgcctacgtgcccaagaaagcctgggggaacatccggctccggacccactcggagtttgtttggctgattggggacaaagaggacacgacggtgaaggccagcaccaagtgcgcctacgacaggattgtgatggccggagacaagctgctcagctccgtggtaccaggttctgcccaagtgtttgacttcatggctgtgtatgggctgacggaagatcaggccctggaggtgagcgaccacttccccgtcgaggtgcagctgaaggaatccaagcggccgacttccaggaggcggaaacacatcgagaggaaataaggtcccccatgtcggccattactgtgctaacaaggaccagtctgttgcctcttatctttatatctaacaaatgtggggtgtggggacgtggggaaggatccagagctacagaagtgtttcttcatcagaaccttccattttggggtcccacattgtactgtggtctcttctctgcacattgatccgcgtggcaaaatatctggggtgcagcgtaaattcagtttattagggctcactatggggaccagagctgggcattcatttgctagaataggcccccctacagtggcggttgtcaagtccattctctggtcagggcccccctgagctctcaatataagtcaaagttgcaagaatatgaaggaaaacataaatacgtacaccccaaatctcacaggtctgcaggctggaattctgggagtattgaggagagaaaatggccattcagttgtgacctaatctgccccccggccccattactaatcagacgggggcgcatccatccagatgtggggtccgggggtacagaggggccagaaccagttattctgggagtttaaggggaaatattatcataaacaggttttctgcttcccaataaaaatgtattttgttgttgaataaatgattgtggatgaaaggtaaaaaaaaaaaaaaa
Translation: MWRLLLFWALFVPHTLGLQICSFNVQSFGESKRDKPAVMNIVRKVISRCDIMLLMEIKDSSDTVIRSLMTQLNSQSETRNQFDLTISQRLGRKSYKEQYGFIYRKKMVSVRGTYQYEDSQPGDPDAFSREPYVVWFEAPSTDVREFVIVPQHTTPEAAVREIDELYDVYLDVKQKWNSENFIFMGDLNAGCAYVPKKAWGNIRLRTHSEFVWLIGDKEDTTVKASTKCAYDRIVMAGDKLLSSVVPGSAQVFDFMAVYGLTEDQALEVSDHFPVEVQLKESKRPTSRRRKHIERK
Donor tissue: