ORFeome > drap1 – XORFeome 2.0

drap1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Dr1 associated protein 1 (negative cofactor 2 alpha), mRNA (cDNA clone MGC:75665 IMAGE:5379921), complete cds
Gene Symbol: drap1
Gene ID: 394886
ORF gb_acc: MG132823
ORF ID: 10171

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064181

Library Location

Plate ID: GDExt11002
Well Location: A12

EST Sequences

Clone: MGC:75665 IMAGE:5379921
Trimmed Sequence: ATGACTACATCGCATCTAAAGCAGTGTATCGAGCTTGAGCAACAGTTTGACTTCCTAAAGGATCTTGTAGCTACTGTTCCAGACATGCAGGGTGATGCTGAAGACAATCATACTGAAGGAGAGAGGGTGTCACGGAGGGGACGAAAACCAGGAAGTAGTCGGAAGAATGGGGGATCTGCCATGAAAGGAAAGGACAAGAAGCAGTCAGAGACAGAGTCAGAACAAGAGGAGGAGTCTGAAGGTACAGAATCGGAGGGAGAGGAAGATATGTGTCCCGATCCTCCTCTAGGCAACCAATCACAAGTCACATTTCAGAGGTGA
Full Trace Sequence: ggctattgccgcttctctggaggcctcagctgagttctgctcccccgccctttccctcgctgaagatgccgagcaagaaaaagaaatacaacgctcgttttcccccggcgagaattaagaagattatgcagacagatgaagaaatagggaaagttgcagccgctgttcctgtcattatctctcgtgcactagaactgttcctgtaaccacttctgaagaaagcatgtcaagtcacacagtcccgaagcgccaaaactatgactacatcgcatctaaagcagtgtatcgagcttgagcaacagtttgacttcctaaaggatcttgtagctactgttccagacatgcagggtgatgctgaagacaatcatactgaaggagagagggtgtcacggaggggacgaaaaccaggaagtagtcggaagaatgggggatctgccatgaaaggaaaggacaagaagcagtcagagacagagtcagaacaagaggaggagtctgaaggtacagaatcggagggagaggaagatatgtgtcccgatcctcctctaggcaaccaatcacaagtcacatttcagaggtgaggaaaagaatgaagtaggaagaacctcttaaagaaaatatttttttatgtgcaaatgaatccctttctcatattgtttttttttttttcccctgcattcttccttcatatggattcgcctgtccagcccccaggctccttctttcactaatttccattctgggactgcactgccccaagtacctgctgctctgccagcaatgccagctccattgccacctaccggctgtgaggaggaggaggaggaggactatgattcgtagccactagatggaccctgtttaattccgttttcatttattcgctttgtttgttttttttattttgattttaaaagggcttgaaagccttggggggggggttgttatatgtgttcttaaatttattaaaaaaggaagtggaggataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTTSHLKQCIELEQQFDFLKDLVATVPDMQGDAEDNHTEGERVSRRGRKPGSSRKNGGSAMKGKDKKQSETESEQEEESEGTESEGEEDMCPDPPLGNQSQVTFQR
Donor tissue: tadpole