ORFeome > drg1 – XORFeome 2.0

drg1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis developmentally regulated GTP binding protein 1, mRNA (cDNA clone MGC:79776 IMAGE:6985358), complete cds
Gene Symbol: drg1
Gene ID: 549048
ORF gb_acc: MG133703
ORF ID: 11260

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080366

Library Location

Plate ID: GDExt11012
Well Location: G06

EST Sequences

Clone: MGC:79776 IMAGE:6985358
Trimmed Sequence: ATGAGCGGGACGCTGGCTAAGATCGCCGAGATAGAGTCCGAGATGGCCCGGACACAGAAAAATAAAGCCACAGCTCATCACCTGGGTTTGCTGAAAGCTCGTCTTGCCAAACTAAGACGTGAGCTGATTACCCCAAAAGGAGGCGGCGGAGGAGGACCTGGAGAAGGTTTTGATGTTGCTAAGACAGGAGATGCTCGAATTGGGTTTGTTGGGTTCCCATCTGTTGGGAAATCTACACTACTCAGTAACTTGGCTGGAGTTTATTCTGAAGTGGCAGCCTATGAATTTACCACCTTAACAACAGTTCCTGGTGTTGTGCGATATAAAGGAGCAAAAATTCAGTTGCTAGATCTTCCAGGCATCATAGAAGGGGCAAAGGATGGAAAGGGCCGTGGTCGCCAGGTGATTGCAGTGGCACGAACATGTAACTTGATCCTTATTGTTTTGGATGTACTGAAACCACTCGGACACAAGAAGATCATAGAGAATGAACTGGAGGGATTTGGAATCAGATTGAACAAGCAGCCTCCAAACATTGGATTTAAGAAGAAAGACAAGGGTGGCATAAACCTCACAGCAACATGTGCCCAGAGTGAGCTCGATAATGATACAGTAAAGAGCATCTTGGCTGAGTATAAGATCCACAATGCAGATATCACACTGCGCAGTGATGCCACTGCTGATGACCTGATAGACGTAGTAGAAGGTAATAGGGTTTATATTCCTTGCATCTATGTGCTGAATAAGATTGACCAGATTTCAGTTGAAGAACTGGATATCATCTACAAAGTCCCACACTGTGTGCCTATCTCTGCCCATCACCGCTGGAATTTTGATGACCTTCTTGAGAAGATCTGGGATTACCTCCAACTGGTGCGAATTTACACCAAACCTAAGGGTCAGTTGCCTGATTATACTTCACCTGTAGTGTTGCCGTTTTCTCGTACTGCAGCAGAAGACTTTTGCACAAAGATCCATAAGAACCTTATCAAAGAGTTCAAATATGCCTTGGTTTGGGGATCATCTGTGAAACACAACCCTCAAAAGGTTGGGAAAGACCATGTGTTGGAAGATGAGGATGTCATTCAAATTGTTAAGAAATAA
Full Trace Sequence: gaaaagccacctagtcaagaggcacaatgagcgggacgctggctaagatcgccgagatagagtccgagatggcccggacacagaaaaataaagccacagctcatcacctgggtttgctgaaagctcgtcttgccaaactaagacgtgagctgattaccccaaaaggaggcggcggaggaggacctggagaaggttttgatgttgctaagacaggagatgctcgaattgggtttgttgggttcccatctgttgggaaatctacactactcagtaacttggctggagtttattctgaagtggcagcctatgaatttaccaccttaacaacagttcctggtgttgtgcgatataaaggagcaaaaattcagttgctagatcttccaggcatcatagaaggggcaaaggatggaaagggccgtggtcgccaggtgattgcagtggcacgaacatgtaacttgatccttattgttttggatgtactgaaaccactcggacacaagaagatcatagagaatgaactggagggatttggaatcagattgaacaagcagcctccaaacattggatttaagaagaaagacaagggtggcataaacctcacagcaacatgtgcccagagtgagctcgataatgatacagtaaagagcatcttggctgagtataagatccacaatgcagatatcacactgcgcagtgatgccactgctgatgacctgatagacgtagtagaaggtaatagggtttatattccttgcatctatgtgctgaataagattgaccagatttcagttgaagaactggatatcatctacaaagtcccacactgtgtgcctatctctgcccatcaccgctggaattttgatgaccttcttgagaagatctgggattacctccaactggtgcgaatttacaccaaacctaagggtcagttgcctgattatacttcacctgtagtgttgccgttttctcgtactgcagcagaagacttttgcacaaagatccataagaaccttatcaaagagttcaaatatgccttggtttggggatcatctgtgaaacacaaccctcaaaaggttgggaaagaccatgtgttggaagatgaggatgtcattcaaattgttaagaaataattcacatattaacctgcaattaggcatgtcagttcagtatttcaagctgtttattaaactgtgcctatttctcaggcagcatgccaataaagcagtacatttcattttcagcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSGTLAKIAEIESEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVVRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNKQPPNIGFKKKDKGGINLTATCAQSELDNDTVKSILAEYKIHNADITLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISVEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLQLVRIYTKPKGQLPDYTSPVVLPFSRTAAEDFCTKIHKNLIKEFKYALVWGSSVKHNPQKVGKDHVLEDEDVIQIVKK
Donor tissue: tadpole